GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.6

Based on 2.681 opinions finded in 2 websites

site_photo4

Nº 159 in 898 in Bath and North East Somerset

Nº 2 of 4 Spanish in Bath and North East Somerset

CUSTOMERS TALK ABOUT DISHES WITH..bravasfriedprawnsfishcheesemeattomatocookedchickenporktapaschorizochurrosmustoctopushoney

comment_iconOpinions

The Food was so fresh and delicious and service was amazing! They made us feel so welcome, we will definitely be returning. Thank you Olé!

site_logo

E M . 2025-05-12

MORE AT Google

The food is extremely overpriced and the Pulpo (octopus) made us feel sick. The portion sizes are terrible— we ordered the king prawns dish and got 5 prawns for nearly £12. Ridiculous. The only thing to recommend is the service and atmosphere. The staff were very friendly and accommodating and service was quick. They were also considerate about having gluten-free options.

site_logo

Aditi Sudhakar . 2025-05-11

MORE AT Google

Highly recommend!! The food was excellent! We loved everything we got food wise. We got both a white sangria jug and a red sangria jug. The white was better than the red. The tables are quite small in order to accommodate the smaller room which means the food gets cramped on there the more that comes out. The music was loud when we walked in, but we asked the waitress to turn it down and she did. It was fine after that. Highly recommend for the food! Will visit again

site_logo

Jackie Ruis . 2025-05-04

MORE AT Google

Delicious food, friendly service.

site_logo

Darren Bradshaw . 2025-04-29

MORE AT Google

I've been here a dozen or so times now. The food and service is always great and it's my go-to place to eat out in Bath.

site_logo

alexander johnson . 2025-04-22

MORE AT Google

Excellent food, perfect service and exceptional atmosphere. Very good representation of typical Spanish dishes of good quality.

site_logo

Fernando Carrasco Mira . 2025-04-20

MORE AT Google

Relaxed tapas spot that offers simple classic Spanish dishes at a slightly lower price than other spots in the city. Very friendly waiter and a nice laid back setting.

site_logo

Julian Sharp . 2025-04-20

MORE AT Google

Visitamos este restaurante durante nuestra estancia en Bath. Nos encantan las tapas y este parecía un lugar de ideas. Sin embargo, se perdió la marca. La mesa era demasiado pequeña para acomodar toda nuestra comida, estaba abarrotada y se sentía apresurada. Pedimos una jarra de sangría, pero obtuvimos 2 vasos, a pesar de que se cobra por una jarra y había un pelo largo en mi comida. Hemos estado en restaurantes de tapas mucho mejores, así que no para nosotros me temo,

site_logo

WoodyAMG . 2025-04-18

MORE AT TripAdvisor

This is as authentic as you can get - they have patxaran!!!! The tables are small but the dishes are perfectly timed and you just about squeeze your sangria or Estrella or lemonade on!!!

site_logo

Eve Baldwin . 2025-04-15

MORE AT Google

My wife and I enjoyed a lovely meal here, we loved the intimate atmosphere it felt like we were dining in someone’s front room. Food was delicious, we enjoyed Chorizo, jamon, croquetas, ratatouille amongst other things! As well as Sangria. Would love to visit again!

site_logo

Jamie Hartle . 2025-04-13

MORE AT Google

Delicious food, especially the aubergine fries. The waitress was really friendly and went above and beyond to make our family comfortable ⭐⭐⭐⭐⭐

site_logo

Matt Stuart-White . 2025-04-11

MORE AT Google

Fabulous good, great service. A bit pricey, but worth it. It's a small place, so it can get a bit noisy and it's best to book in advance.

site_logo

Murray Cowell . 2025-04-03

MORE AT Google

Nice tapas bar tucked on a 2nd level of historic Bath. The food was superb and service great! Patatas Bravas are on the hot side, and tuna steak was my favorite.

site_logo

Miguel Vega Jr . 2025-04-02

MORE AT Google

Excelente comida y fantástico servicio Muy buenas opciones vegetarianas y la comida es fresca y sabrosa. Gran almuerzo del Día de las Madres.

site_logo

HW01 . 2025-03-30

MORE AT TripAdvisor

Excellent tapas, particularly for us vegetarians. Owner was great (sorry, can't remember name). Lovely atmosphere. Don't be put off by the small entrance and having to walk upstairs, well worth it. Be back soon

site_logo

Frangipananne . 2025-03-28

MORE AT TripAdvisor

¡Las mejores tapas que he probado, incluso en comparación con algunos lugares de España! Me encanta este lugar por su autenticidad y precios asequibles. Un montón de tapas para elegir, el personal está bien informado y muy servicial y toda la experiencia te hace sentir como si realmente estuvieras en un bar de tapas en España. No puedo recomendar lo suficiente

site_logo

Fearless10753766042 . 2025-03-25

MORE AT TripAdvisor

Food was excellent, traditional Spanish cuisine. And in addition the staff were very helpful. Best tapas in town by far!

site_logo

Kalin . 2025-03-25

MORE AT Google

If you are looking for a culinary experience that transports you directly to Spain, you cannot miss Ole Tapas. From the moment you walk through the door, you are enveloped in a welcoming and authentic atmosphere that reflects the rich Spanish culture. Every bite is full of flavor, with fresh, high-quality ingredients that highlight the essence of each recipe. The service is exceptional, the staff is friendly and always ready to recommend the perfect wine to accompany your meal. In addition, the decoration of the restaurant creates an atmosphere that makes you feel as if you were in Spain itself. Without a doubt, a gem that any lover of good Spanish food should visit. An experience you won't forget!

site_logo

Lina marcela Zuñiga Arango . 2025-03-25

MORE AT Google

There's a reason this place is busy and has a rating so high. They do everything really well, simple menu, good wine, great staff. If you're after Tapas, look no further.

site_logo

Brett Ward . 2025-03-19

MORE AT Google

No parece nada especial y diminuto, fuimos a caminar y la señora nos mostró una mesa. Estamos muy contentos de que nos alojamos, la comida era fantástica, la gente tan amable, las gambas estaban fuera de las listas! No te pierdas este lugar es realmente especial que no podemos esperar para volver.

site_logo

goodclaret . 2025-03-17

MORE AT TripAdvisor

My wife and I came here on a whim seeing how nice it looked online. We were able to get seated quickly, even on a Saturday evening which I wasn’t expecting! The staff were incredibly friendly and informative, giving suggestions on the food and how best to eat it. The food itself was absolutely incredible, I’ve personally never had tapas before but now I want even more! The chorizo was delicious and Smokey, the meatballs were so good and the Patas was incredible but the real showstopper was the Scallop. It was served in the shell with onions and breadcrumbs and it was something else. 10/10 would definitely come back and would definitely recommend to anyone visiting Bath

site_logo

Jack Bepis . 2025-03-09

MORE AT Google

Fantastic tapas in a great little venue. Would thoroughly recommend, will definitely be going back!

site_logo

Paul Richardson . 2025-03-09

MORE AT Google

Incrivel! My partner, myself and a friend visited tonight for a catch up dinner. Service was fantastic and the waiter + host made us feel at home. Small but very cosy atmosphere, with an excellent choice of dishes. The octopus, patatas bravas and carne con salsa come highly recommended. Excellent chef that brought me back to my childhood in Olhão and I think Ole Tapas represents Spain proudly. Don't skip! You got to eat here.

site_logo

Cosmo Vati . 2025-03-01

MORE AT Google

Absolutely lovely place, couldn't recommend it highly enough. Loved the cosy atmosphere, the food was stunning and it had a real authentic Spanish feel to it

site_logo

Kyle Frew . 2025-02-27

MORE AT Google

Small cosy atmosphere and outstanding tapas. We had 6 dishes between 2 of us which was the perfect amount. Staff very friendly and helpful.

site_logo

Ross Jackson . 2025-02-24

MORE AT Google

Lovely small restaurant with a great atmosphere. Very friendly and attentive service from the staff and good selection of tapas dishes.

site_logo

Tom Muirhead . 2025-02-21

MORE AT Google

Fantastic evening. The staff were brilliant, food delicious Thank you

site_logo

Stephanie Helyar . 2025-02-21

MORE AT Google

All round fantastic. Best tapas I have had in a long time, delicious food. Brilliant staff (Friday 14th Feb)! Loved the music and atmosphere and enjoyed the intimate setting.

site_logo

Clare Mccluskey . 2025-02-18

MORE AT Google

Great for late afternoon stop. Gambas must have. calamares, potatoes bravas all good. Servings small for the pricing though. Recommended. Will stop by again if in bath!

site_logo

Siang Loong Wang . 2025-02-16

MORE AT Google

Mi 4a vez aquí y el restaurante sigue siendo muy bueno. La berenjena tempura es la mejor que he comido. Ambiente genial y la comida buena relación calidad-precio por la excelente comida.

site_logo

Sarah L . 2025-02-13

MORE AT TripAdvisor

Brilliant! They were great at accommodating quite a large crowd for the size of the place. Food was amazing, service was great, would recommend!

site_logo

Steve Reyes . 2025-02-13

MORE AT Google

A no pretense tapas restaurant serving the most delicious food. Chorizo is absolutely delicious, as is the Jamon Serrano. Well worth a visit. Booking is needed due to high demand

site_logo

Craig Charles Stewart . 2025-02-09

MORE AT Google

Amazing authentic tapas in a cozy atmosphere. Very friendly staff, good music & vibes! Tortilla and Bacalao con Tomate are especially delicious.

site_logo

Hal Wallis . 2025-02-06

MORE AT Google

Awesome little Tapas and Wine Bar in Bath. My daughter found them online. Excellent food and lovely service by William. He was very knowledgeable on Spanish Wines. Food was excellent, especially the Calamari. Excellent. Highly recommend.

site_logo

Thomas Keefer . 2025-02-05

MORE AT Google

Service? Impeccable Staff? Amazing Food? Absolute perfection 👌 The atmosphere is lovely such a nice vibe and the staff here are fantastic. Thank you for making our dining experience fantastic The meatballs were absolutely brilliant

site_logo

John Roberts . 2025-01-25

MORE AT Google

Best Spanish and tapas in Bath, possibly the whole South West. Great food. Great staff. Love it.

site_logo

Sarah Dickinson . 2025-01-04

MORE AT Google

Auténtica y fresca cocina española en un hermoso lugar en Bath: ¿qué más se puede pedir? ¡Javi y su chef nos dejaron boquiabiertos con sus deliciosos platos! Disfrutamos del • Pan con tomate: excelente con tomates deliciosamente afeitados; sabores bien equilibrados. • Patata bravas*: el alioli tiene un ponche de ajo y se contrarresta perfectamente con la salsa roja a base de tomate y especias • Pulpo a la plancha: encantador... la imagen vale más que mil palabras aquí. Haga una reserva si es posible, pero siéntese en el bar y disfrute de lo contrario! *Tienen otro nombre para ello, que se me escapa. ¿Patatas bravadas? Deben de llamarse *patatas bravissimas*!!

site_logo

Sean M . 2024-12-30

MORE AT TripAdvisor

the sardines are fantastic as are the calamari and the beer is great- very cold! The service is fast and friendly. The venue is very small but has a nice atmosphere only gave four stars as the music was too loud for such a small space. tbh i didn’t ask him to turn it down as he seemed to be enjoying it.

site_logo

Clare Huggett . 2024-12-29

MORE AT Google

Second visit and it was just as good as the first, I think you could pick out anything off the menu here and it would be excellent. Staff really friendly, the restaurant itself is very small which adds to its charm, but at the same time you do not feel crowded in at all. Only real negative would be that drinks are quite expensive (£9 for a pint), however that wouldn’t be enough to stop it getting 5 stars as everything else is brilliant.

site_logo

Aaron . 2024-12-21

MORE AT TripAdvisor

Lovely vibrant atmosphere with the Latin music in an intimate restaurant with great service. Food was incredible especially the prawns pastas bravas and the fresh bread.

site_logo

Charl M . 2024-12-15

MORE AT TripAdvisor

A really lovely experience. Comfort in every way. Great tapas. Really friendly vibe. Particularly important if dining solo. And I would recommend to everyone as one of the best places to eat in Bath. Already looking forward to my next visit.

site_logo

Saber K . 2024-12-13

MORE AT TripAdvisor

Highly recommended. Nice food and nice people in there.

site_logo

Brian Wong . 2024-12-10

MORE AT Google

Delightful waitress but food not good. we ordered the mushrooms with garlic. they tasted nasty at the time and we should have sent them back or not eaten. we were later very unwell.

site_logo

Deborah_L123 . 2024-12-07

MORE AT TripAdvisor

We went last night to Ole Tapas in Bath and our overall experience was underwhelming. The tables are too small for 4 people to sit around. Most people had to turn the lights on their phones to read the menus (white text on a pink/peach background). I was constantly being bumped into and actually had to move my stool at one point during my meal so the waitress could get by with another tables order. The two tables as you enter the restaurant had 2 groups of 4 people around each table and it meant that their backs were actually touching each other. When you're paying that sort of money they're charging for a meal you should expect some degree of comfort. The waitress was rushed and not particularly helpful in explaining the menus and getting our drinks. We could only order 2 tapas' each as the table was full with 4 drinks and 12 plates/bowls. I asked the waitress after she had told us people are advised to order 3 tapas each for a meal, I pointed out that there was no way we could get that many plates on the table and her reaction was order 2 then when you've finished order another 1. . . . Really!! My previous experiences in a Tapas bar (of which I've been to many) have always been that it's nice to pick between the different bowls taking a small amount from them to combine the lovely flavours of Spanish food. We had to ask for our last tapas as we had finished the other 7 tapas' which was the Pollo Asado only to be told that the Chicken was still cooking!! The food itself was amazing especially the Patatas Bravioli & the Huevos Rotos Con Chorizo were both exceptional. I would go back there as a couple but definitely not as a group of four.

site_logo

Chipsy W . 2024-12-07

MORE AT TripAdvisor

After reading the reviews thought what a place definitely worth a go…… Well what a shock the, we were greeted by an almost pub back doorway with the stairs to match… the atmosphere was interesting as an understatement appears this is the place to before a night out in town as a cheat meal. The food was over priced for the quality and not quite the experience you would expect from a restaurant that is listed so highly Three words to sum it up Small,loud and overpriced

site_logo

Charles Pargeter . 2024-11-29

MORE AT Google

Amazing tapas located in a quaint flat. Very tight and a bit of stairs but not a bother for our family. The food was fantastic and pretty quick to get to table. Our waiter was great and very accommodating. We would absolutely recommend to anyone!

site_logo

Eric R . 2024-11-25

MORE AT Google

Lovely tasting food and atmosphere

site_logo

James Inskip . 2024-11-18

MORE AT Google

The food was amazing, we ordered 6 dishes between two people and were so happy with all of it! The server was very friendly and helped choose what wine to order with our meal - would go again!

site_logo

Robyn Burns-Jackson . 2024-11-11

MORE AT Google

Honestly some of the best food we have ever had! We enjoyed all of our dishes and would happily come back to Bath just for this restaurant

site_logo

Ellie P . 2024-11-10

MORE AT Google

We made a booking at a tapas restaurant for the first time with my husband we just wanted to try a new thing but William was the person who made it really special so i would give my opinion as it would be a very bad choice to not visit here.

site_logo

Tuana Güler . 2024-11-04

MORE AT Google

We had a good visit. The service was fast and we enjoyed the food and sangria. The high bar stools are definitely designed so customers don’t stay too long.

site_logo

Marina Ragageles . 2024-11-04

MORE AT Google

Not a fancy place, but with style, and real food with flavour, and plenty of encouragement to share dishes and enjoy the variety of tastes that's the essence of tapas.

site_logo

Tony Newton . 2024-10-30

MORE AT Google

Fantastic! A teeny weeny venue that delivers delicious authentic tapas with great service! Highly recommend 👌

site_logo

Clint White . 2024-10-28

MORE AT Google

Poor entrance decor, intrusive music, decent enough food, tasted authentic, but the problem was with added VAT plus 12.5% service charge which made it expensive considering the overall experience.

site_logo

Chris G . 2024-10-21

MORE AT TripAdvisor

Excellent, authentic, and delicious food. We visited as a family this evening. We had amazing meats, cheese, patatas bravas, squid ink salted cod, bread, and olives. So authentically Spanish. Cava was good, churros delicious and excellent, friendly service. Thank you.

site_logo

Big Welshman . 2024-10-21

MORE AT TripAdvisor

Great food in a small space. The bread was fantastic.

site_logo

Gavin Sharples . 2024-10-20

MORE AT Google

Absolutely incredible food, one of the top spots in Bath. Service was great, everyone was friendly and the actual restaurant is lovely.

site_logo

Joe C . 2024-10-19

MORE AT TripAdvisor

Wow.. from the warm welcome... incredible food to the fabulous atmosphere, our trip to Ole tapas was great. This place was buzzing and we really enjoyed our visit. Thank you

site_logo

Anne C . 2024-10-14

MORE AT TripAdvisor

Good food and a warm ambiente. The sobrasada on toast was our favourite.

site_logo

Olivia Rast . 2024-10-08

MORE AT Google

Beware the size of this place, it’s tiny! So not much good if you’re a party of more than two, BUT the staff are just brilliant! So much character and they can’t do enough for you. The food was very tasty, each dish coming to the table when ready, so don’t expect everything to arrive together. We were kindly surprised with a complimentary glass of bubbles since it was our anniversary. Overall, a very warm and authentic tapas experience, reminiscent of the Spanish backstreets.

site_logo

Beck Spencer . 2024-10-06

MORE AT Google

One of the nicest restaurants in Bath, great atmosphere and lovely food

site_logo

Joe Coles . 2024-10-06

MORE AT Google

Excellent food, authentic and fun atmosphere in this tiny restaurant, I come back again and again and love it every time

site_logo

Irina B . 2024-10-01

MORE AT Google

A massive thank you to Ned and his colleague for looking after us tonight. Wonderful food, intimate but welcoming ambience and great, friendly, non-pressured service. Ole!

site_logo

CD H . 2024-09-28

MORE AT Google

Amazing! I cannot recommend this place enough. It is my new happy place. The tapas is the best I have had anywhere, even in Spain. I wish it was bigger and then more people could experience Ole but then it would detract from its uniqueness and you wouldn’t get the service. Loved it!

site_logo

Thomas D . 2024-09-26

MORE AT TripAdvisor

Good Spanish food in Bath, very tasty and intensive taste. Restaurant space is a bit small, suitable for small group. Garlic prawn is nice. Clam is very fresh and well cook. Iberico ham is nice prepared and juicy. Bread and Churros is so delicous, recommended to try. Staff is warm welcome with good service.

site_logo

Koko Lertaraya . 2024-09-09

MORE AT Google

Awesome little place for Tapas, brilliant ingredients. And sangria!

site_logo

Vince Subo . 2024-08-28

MORE AT Google

Wonderful. Booked on a quiet Monday evening to celebrate our completion of the Cotswold way. A very warm welcome that continued throughout the evening. Tapas was amazing quality and I would recommend the chicken thighs. Just wish we lived closer to visit again. A brilliant night.

site_logo

jammy71 . 2024-08-20

MORE AT TripAdvisor

Visited Bath for the day and went to Olé Tapas for lunch. Great atmosphere, delicious, authentic tapas, and very moreish white Rioja (shame the advice about just buying a bottle if we were going to have more than two glasses came too late). Staff were welcoming and attentive. Chipirones and octopus were the food highlights!

site_logo

Rob . 2024-08-19

MORE AT TripAdvisor

Lovely place, fantastic authentic food, a very personal experience due to the size. Loved every bite and moment. My daughter 12 has found her new food love in wonderful Tapas.

site_logo

Iain A . 2024-08-18

MORE AT Google

My wife and I stopped in on Sunday night. We love tapas and our hotel front desk told us this was an intimate setting on the first floor (we’d call it the second floor in the states) with delicious food. They weren’t exaggerating. It’s a really small place with exceptional food. Our server was great too! We had lots of interesting conversation with him about everything British and American. A very fun night and we even got to chat with the owner who was a great guy! This just wouldn’t have been possible in a big crowded American restaurant. We had an amazing time and would HIGHLY recommend Ole to anyone in Bath!

site_logo

Jacob Pulford . 2024-08-12

MORE AT Google

A small place but so good… we where already dancing up the stairs to the music on the way in… the staff where so nice and inviting. The menu was simple and tasty. It had that Spanish atmosphere, Ole!Arriba!!. “The yummiest tortilla I’ve ever had” (my friend Freddie). Will fill your cravings and u might consider dessert 😜

site_logo

grainne SHEAHAN . 2024-08-11

MORE AT Google

Absolutely divine. Wonderful host. The pork and the chorizo dishes were just amazing

site_logo

Dave Henry . 2024-08-05

MORE AT Google

Inexplicable voucher policy. Uncaring staff. Avoid!

site_logo

Alex Mason . 2024-08-03

MORE AT Google

We bought my parents a gift voucher which they weren't able to use all in one go. They refused to allow them to save the rest for a later date so they had to buy overpriced wine to use it all up. Ridiculous when the gift cards have 'check my balance' on them.

site_logo

Jane Mason . 2024-08-03

MORE AT Google

THIS PLACE DESERVES TO BE CALLED THE BEST TAPAS PLACE IN TOWN🥹🥰 so gooood! Try the Blue cheese pork taps!

site_logo

ShiuanChiam . 2024-07-27

MORE AT Google

I had a wonderful experience dining here. The tapas were delicious, especially the patatas bravas, aubergines and churros. The service was incredible, great vibes from the wait staff. 10/10 I also came away with a great new song for my playlist from their restaurant soundtrack - a bonus!

site_logo

Benjamin Bogorad . 2024-07-17

MORE AT Google

Thank you for feeding our group even though we came in right before your kitchen closed. The food was absolutely incredible, the wine was delicious, and the service was top notch. Our highlights were: pan para mojar, tabla mixta (omg the jamón ibérico!!), patatas bravioli, gambas pil pil, albóndigas, pollo asado, and solomillo a la plancha! That was literally everything we ordered it was all so good so I imagine if we had ordered additional dishes they would have been just as good. Thank you again and if I’m back in bath I will be back to this establishment

site_logo

Kristin Neely . 2024-07-10

MORE AT Google

Food is not good and way too expensive for the quality. Do not recommend. Yet the staff is nice though she recommended a dish that is very meh.

site_logo

Ellen Chao . 2024-07-07

MORE AT Google

We’ve been there 6 years ago when we first visited Bath. We were in Bath again last Thursday and like it was 6 years ago same delicious food and drink. The service and the serving was extraordinary. Amazing place, amazing food. Well done. Thank you!

site_logo

István Szilágyi . 2024-07-06

MORE AT Google

Fantastic food and service! If ever in bath will be straight back there!

site_logo

Luke Walters . 2024-07-01

MORE AT Google

It's a little piece of Spain in Bath. The place is small but very nice. The cook is Spanish and made us feel at home. The music is all Spanish and we loved having delicious Spanish dishes while listening to our music. Highly recommended

site_logo

Esther M . 2024-07-01

MORE AT Google

Great food, lively, good selection, everything looked so good we over ordered!

site_logo

Harry Thomas . 2024-06-30

MORE AT Google

Fun little walk up tapas bar with lots of personality. Our favorites: red sangria, garlic prawns, marinated olives, grilled octopus, and the churros served with a gorgeous dark chocolate sauce. Yes please!

site_logo

Karma Jensen . 2024-06-29

MORE AT Google

Absolutely delicious food and such welcoming and attentive service. Would 100% recommend.

site_logo

Charlotte Dutfield . 2024-06-17

MORE AT Google

Tiny little spot but amazing good and delightful service

site_logo

Sergio Almeida . 2024-06-13

MORE AT Google

Delicious food and absolutely lovely staff! Though the restaurant is relatively small, it has a very warm and lively atmosphere. Will definitely come back here when I’m next in Bath.

site_logo

Verity Fenn . 2024-06-11

MORE AT Google

Tasty food and great service, will definitely be coming back!

site_logo

Jordan McNabb . 2024-06-11

MORE AT Google

Absolutely wonderful! Everything was delicious, the atmosphere was fire, the peppercorn and cardamom gin and tonic was a revelation, delicious rosé, and the service was funny and warm. Go here!

site_logo

Sam T . 2024-06-11

MORE AT Google

This place was recommended to us by our hotel bartender and it was delicious! Great atmosphere and service and everything we ordered was delicious!

site_logo

KC Wilder . 2024-06-07

MORE AT Google

Exceptional. The highest quality Tapas served with an attention to detail that is second to none. A small restaurant, but all the better for it! Cannot recommend highly enough. The Patatas Brav-aioli were a highlight - the smoky chipotle flavour of the sauce made a very pleasant change to the overwhelming tomato sweetness you get in some versions.

site_logo

Matt Storey . 2024-06-06

MORE AT Google

This was an amazing lunch. The ingredients are of the highest quality and they are rightly proud of their food. Too many businesses don’t think enough about food quality but this place really care about it and it shows. We had : tomato salad - seasoned beautifully, the boquerones - fab, brilliant squid, tender gambas, an oozy tortilla, the special tortilla de camarones, the Iberico pork served slightly rare as it should be, tender Pulpo, Albondigas in the best tomato sauce all washed down with a bottle of manzanilla and a few cañas rounded off with some cortados. This is tapas done right and we really want to return when next in Bath.

site_logo

Tdavid89 . 2024-05-30

MORE AT TripAdvisor

The service was good, friendly, and super quick. The place was small, clean, and cute. Quality of food was good, but not super authentic. So if you are not looking for authentic then this isn’t the place for you.

site_logo

Carl Tuffley . 2024-05-26

MORE AT Google

Food was absolutely divine, and service was impeccable. A massive thank you to the blonde waiter for running out of the shop to return my shades!

site_logo

Henry Chang . 2024-05-25

MORE AT Google

I booked a table to celebrate my wife's birthday at this fabulous intimate Tapas restaurant. When we arrived there was a Happy Birthday sign at our table and the staff were lovely. We ordered a selection of dishes, all of which were very tasty, & beer. It reminded us of Tapas restaurants we've visited many times in Spain and definitely as good. When we had finished they brought out a complimentary slice of their Tarta de Santiago with a candle and played "Happy Birthday". A lovely celebratory lunch!

site_logo

gazuk53 . 2024-05-18

MORE AT TripAdvisor

Intimate first floor setting. High tables. Lively atmosphere. Simple delicious traditional Spanish food. It's a Bath institution, deservedly.

site_logo

John . 2024-05-04

MORE AT Google

Gorgeous find, small and intimate, really tasty food and great staff. A great atmosphere, feels informal and very attentive

site_logo

busymumlikeseatinout . 2024-04-28

MORE AT TripAdvisor

A great spot for un sabor de España! This place gets it right. Cosey bar hidden above a cheese shop in the centre of the city. The guys here make you feel very welcome with loads of Spanish hospitality. Great homemade Tapas and really good Spanish beers. We keep returning whenever we are in town! 🍻🥘

site_logo

Brekky Ninja . 2024-04-20

MORE AT Google

Lovely small tapas bar, more locals than tourists. They have a rather rich menu and always some specials. Good sherry selection by the glass and Estrella Galicia on the tap 😋

site_logo

Elif Suzmecelik . 2024-04-07

MORE AT Google

Best paella I have ever had! Great staff and cool restaurant - feels like you are really in Spain!

site_logo

Joshua Burks Way . 2024-04-06

MORE AT Google

Lovely place with delicious food. The service was friendly but a bit forgetful (we had to ask for certain orders twice or three times). It is a small restaurant and for dinner it was packed. The music was very loud. So the place may not be enjoyable for everyone.

site_logo

Renard T . 2024-04-06

MORE AT Google

Similary restaurants in South West

restaurant_img
4.5

2485 Opinions

location-icon12a North Parade
Spanish
outdoor_seating_166598takeaway_166598delivery_166598

Came here with my vegan friend to find that the menu on their website is misleading and outdated. When we arrived at the restaurant we were given a different menu which has less vegan options and this was disappointing for us as we wanted to come here because they have some vegan options for my friend. We asked about vegan paella and they said it’s for £60 for two pax - how crazy is that as there would be no vegan protein and only veggies surely it is not that expensive. I had the chicken croquettes and the portion was so small for the extortionate price. Would not come here again unfortunately.