GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.5

Based on 296 opinions finded in 1 websites

site_photo3

Nº 136 in 813 in Derby

Nº 6 of 16 Asian in Derby

CUSTOMERS TALK ABOUT DISHES WITH..picklecurrypickleslambricechillimeatfishspicychickencookedmust
Score
OpinionsNoteTripAdvisor2964.5

comment_iconOpinions

Dined with family. Lovely clean restaurant, the food was absolutely amazing and the staff were super friendly and helpful. Brilliant value for money 😁

site_logo

Jenny B . 2024-08-11

MORE AT TripAdvisor

This was our first visit to this restaurant having had it recommended to us. We thought the food was exceptionally tasty, large portions and we appreciated the hot plates and dishes which is rare. It was very reasonably priced too. Staff were friendly, helpful and attentive. We would highly recommend and will definitely revisit soon.

site_logo

Joan P . 2024-07-27

MORE AT TripAdvisor

I was invited by the inimitable "Baz Paneer" to join him and his sister and brother-in-law for an evening gathering at Gurkha Junction the well-known Nepalese restaurant in Derby. It was a Sunday night and the whole restaurant was full. The evening was great fun and the food delicious. We were entertained by the Jungle Club Band who sang a range of uplifting and famous gujarati and punjabi songs. Many of the guests got up to dance in Indian style which was great fun to watch. The buffet-style food was well received by all the guests with an excellent mix of vegetarian and non-vegetarian dishes to suit all tastes. Especially noteworthy were: allo tikki with cholay and patra amongst the starters and Chicken Bhutuva (a dish which was new to me and I would travel back to Derby just to have it again!) and a superb Tadka Dall. The guests had travelled from afar to dine that evening (including Leicester and Nottingham). There was a great family atmosphere and Naresh was the "perfect host". Gurkha Junction is a gem of a restaurant and deserves all the plaudits that it gets. Roll on the next visit....

site_logo

JAMES P . 2024-06-22

MORE AT TripAdvisor

Absolutely fantastic. I cannot rate this restaurant high enough. The food was simply amazing. I wanted to try something different so took the advice of our waiter, he couldn’t have got it any better. Great value for money, great service and the most delicious food.

site_logo

Philip R . 2024-05-12

MORE AT TripAdvisor

I cannot give this place enough love, I made an oopsie, one simple conversation fixed it, excellent communication, if you’re ordering get the daal, lemon rice and parathas because you will have an experience.

site_logo

Samheinousanus . 2024-03-02

MORE AT TripAdvisor

We have just had a quality meal with great choice served by friendly helpfull staff at a reasonable price and can recommend it to all and will be back very soon

site_logo

nick r . 2023-09-01

MORE AT TripAdvisor

I hadn't seen that it was a buffet meal on Sundays when I booked, but there appeared to be plenty of choice. The big problem was that the food was barely lukewarm. When I commented I was told that the burners hadn't been lit. No apology offered and i did wonder if a food inspector visited with a temperature probe, what ratings they would achieve. Didn't feel that I got my moneys-worth as I really prefer hot food. My grandson even commented that the plate was hotter than the food, without having heard me talking to the waitress. Therefore the combination of cool food and indifferent staff means I won't return I visited with family, adults and children (pre-teens)

site_logo

fletchgill56 . 2023-05-14

MORE AT TripAdvisor

Food was totally delicious. Honestly say some of the best cooked meat I have ever had. Portion sizes are brilliant After a couple of poppadoms and samosa starter I couldn’t manage much of the main dish. Very impressed with food. Very well presented Tasty Awesome portion size The place is a little dated inside but doesn’t detract from the quality. My only critique would be the waiter wearing casual clothes, north face gilet and trainers. Not sure if it was the owner who was chatting to us but such a lovely person. I would strongly recommend calling in for a meal or even ordering a takeaway, you won’t be disappointed.

site_logo

Klos53 . 2023-03-31

MORE AT TripAdvisor

Airy,clean, surprisingly spacious, my first impressions were good. Staff are courteous and pleasant and, although we hadn’t booked, were immediately shown to a table. There was plenty of choice for me with a number of vegetarian and vegan options. The food was beautifully presented, cooked to perfection and plentiful. And, it certainly didn’t break the bank. I’m sure I will be visiting again soon.

site_logo

tastylady2015 . 2023-03-24

MORE AT TripAdvisor

Came here with a couple of friends on a Friday night after a recommendation. Was very impressed with the high quality of the food. I’ve had a few Indian meals in my time but this was right up there with the best (if not THE best). We had the fish sharing starter which was far better thank I expected. It was delicious! For my main I had goat curry. It was amazing … so tender and packed with flavour. I’m salivating just thinking about it and can’t wait to go back. Staff are also great. Thank you for an amazing time and exceptional food.

site_logo

PuckaTucka . 2023-03-20

MORE AT TripAdvisor

We have just eaten in here for the first time in a while. We were not disappointed. The food was amazing and plentiful, the staff very friendly and helpful and the bill was very reasonable. There were 4 of us, and all were extremely satisfied with our service. We will certainly be returning.

site_logo

ianblythman . 2023-02-18

MORE AT TripAdvisor

My husband and I enjoyed a delicious meal here on Saturday night. Attentive service. Good sized portions. Happy for us to linger with drinks and coffee. Thank you

site_logo

Sheila2568 . 2022-08-29

MORE AT TripAdvisor

Amazing food and great service friendly and polite Always enjoy the chicken mango Nepal and special rice cooked to perfection

site_logo

G2148OTcathyb . 2022-08-27

MORE AT TripAdvisor

Lovely friendly Nepali restaurant. Host Ram was very welcoming and so kind. Our first visit after many years. Kitchen accommodated all our requests and produced a fabulous dinner. Momos are a definite. Do try the Gurkha chops and the methi paneer. All dishes served with pride. Quality of meat was exceptionally good and cooked beautifully. Would highly recommend.

site_logo

Samragi . 2022-08-12

MORE AT TripAdvisor

Visited here for a meal on a recommendation. We were greeted with weeds all around the outside of the restaurant and as we tried to park at the rear (two full spaces) We noticed the open back door (due to the heat, which is understandable) was battered and broken and needs to be renewed. Anyway we ventured in and the inside was more pleasant. The food was good but stating that the set meal deal is three courses is misleading as they are saying that curry and rice is two courses ! We asked for coke which was on the menu for £1.70 for a half pint, but we were given pints at £2.50 each and did not realise. We then had the ice cream dessert which was listed on the menu as 'unforgettable'.. I am afraid I am unable to remember what it was ! The staff were friendly and pleasant, but there was a lad about 13 years old serving us. He was efficient enough, but had no knowledge of the menu or ingredients and few customer service skills. Is he there perhaps as the minimum wage for children is less ?. All things considered, I think it is okay but attention to detail is needed and a bit of a tidy up. Beware of the set menu at £11.95pp. Because once you have had drinks and dessert, the bill will be over £40.

site_logo

Derbyshireflyboy . 2022-07-10

MORE AT TripAdvisor

We have been using this place to eat in and out through the last couple of years and have loved it... the latest takeaway however was a real disappointment. I don't know whether the chef has changed or they are trying to cut costs but there was virtually no protein in the curries or chunks of vegetables - they were almost completely sauce. I may try once more just to see whether it was an off day but there will be no more opportunities after that. Its a quiet expensive takeaway - it used to be worth it but this latest one was very poor across all dishes.

site_logo

Sandra G . 2022-05-29

MORE AT TripAdvisor

Went here tonight with family; thought we would give it a go because we enjoy Nepalese cuisine and we had read lots of good reviews. We were all really disappointed with the whole experience. Firstly, it's a bit of a dump inside: cheap, nasty, tatty and drab, plus the toilets are simply awful. Parking is inadequate and then we were greeted with a broken fridge outside the door. Next, we were served by a young teenager who was going her best but clearly new, needed a lot of support and had no refinement...employing such a youngster is never going to end well. Then, the food: what a let down. Out of the starters, the only half decent dish was the mixed tikka - the chilli fish was a mound of black, greasy chunks of mess and the lamb choyla was inedible...my partner picked at it and left most. Then the mains: all underwhelming, bland and lacking any depth of flavour and clearly poor quality ingredients. Finally, we were all surprised to be served a bottle of Lidl Chenin Blanc that costs roughly £5 (and is basically naff plonk) and be charged £16.95 for it. Yet, despite everything being pretty poor, the prices are not cheap at all! We did not overindulge and yet paid £100 for three of us. Add the fact that we were sat near a table of loud, rude and foul mouthed chavs to all of the above and it won't surprise you to learn that we won't be returning! We will stick to the Himalyan Gurkha on Macklin Street which is miles ahead on all fronts.

site_logo

sarmac . 2022-03-11

MORE AT TripAdvisor

We recently dined here with family. The staff were really friendly and attentive and were able to advise on many of the dishes. The food was absolutely delicious and we all agreed that this was the best curry we have had in a long while. We would definitely recommend a visit.

site_logo

Dolleyh . 2022-02-26

MORE AT TripAdvisor

Very easy to order either online or by phone, we phoned due to having a few allergy questions which were quickly answered, allowing us to order. The order was ready on time for collection, and the front of house very polite and helpful. Our food was very good, with well balanced spice levels which did not overpower the flavours, good portion sizes too. Prices are competitive.

site_logo

Ian M . 2022-01-05

MORE AT TripAdvisor

The food and service was very good. There was an excellent choice of dishes for us to choose from. Overall it was a great experience.

site_logo

Fauldsian . 2021-11-02

MORE AT TripAdvisor

Ordered on a busy Saturday evening from Gurkha Junction restaurant and was surprised how quickly the food arrived, they missed something again but was quickly corrected on a phone call, great portions and very tasty food, we all had different meals and all excellent, well...

site_logo

TeamWard . 2021-06-02

MORE AT TripAdvisor

Fantastic in every way!! The food is amazing and delicious! Superb, fresh quality ingredients! Restaurant standard food as a takeaway is unheard of usual Kay, but this is the real deal! We ordered the lamb options from the Chef’s Specialities, the delivery was prompt and...

site_logo

Eliza-Doo1 . 2021-05-01

MORE AT TripAdvisor

First use of Gurka Junction, takeaway collection for our New Years Eve food, plenty of choice on the menu, lovely food (Chicken Rogan Josh, very tasty), easy order. disappointed no poppadoms which i discovered when home, hopefully not next time.

site_logo

TeamWard . 2021-01-01

MORE AT TripAdvisor

Meant to be a lamb rogan Josh, was just 4 bits of lamb and curry sauce. Found a thick black hair in my rice! Most of the meal had spilt into the carrier bag. Never again, now I'm ordering from another one. I can highly...

site_logo

louisesQ8955PG . 2020-10-11

MORE AT TripAdvisor

Went for a meal with family, thoroughly enjoyed. The food was amazing, generous portions, delicately spiced and a variety of flavours. The owner was really welcoming and attentive, making the experience something we will happily be returning for. Thanks very much!

site_logo

241ashap . 2020-09-23

MORE AT TripAdvisor

We have just been for our first meal here since lock down, having had a few takeaways, and were not disappointed. The service was excellent, and the food amazing. The staff were very friendly, the new owner introduced himself to us and checked everything was...

site_logo

ianblythman . 2020-09-11

MORE AT TripAdvisor

We visited the Gurkha junction last night and what a lovely experience we had. We received a warm welcome. The food was presented beautifully and tasted just as nice. The gentleman who served us explained that this was their first week under a new management...

site_logo

jem2904 . 2020-09-04

MORE AT TripAdvisor

Absolute rip off- they advertise that they have the meerkat offer go in to eat our meal and when it comes to paying the bill they deny that they use the meerkat offer. This is an absolute disgrace and makes a mockery of the Meerkat...

site_logo

Joseph W . 2020-09-01

MORE AT TripAdvisor

Travesty!!! Went on the meerkat after being advertised and confirmed to be told At payment stage this offer wasn’t running. Very rude man after explaining that we had travelled for this. The waitress confirmed that 2 other tables had had the same problem this evening...

site_logo

Foodexpert73 . 2020-09-01

MORE AT TripAdvisor

We have had a second take away from here during lock down. The food is as good as eating in. We love this place, and would recommend to anyone.

site_logo

ianblythman . 2020-06-20

MORE AT TripAdvisor

Excellent food great fast service takeaway definitely recommend to a friend the curry rice nann chips everything 👍🏼

site_logo

rachelsJ3851SP . 2020-03-13

MORE AT TripAdvisor

We like to try restaurants out on our own then we take friends and family. Came across this restaurant seen the views thought we give it ago break the week up. Staff very pleasant and helpful if not sure what to order. Food came out...

site_logo

clairecuts . 2020-02-12

MORE AT TripAdvisor

We been here so many times food and service is excellent.one of the best restaurant in Derby.we will highly recommend this restaurant my friend and family we will be back soon .

site_logo

Tokyo2038 . 2020-01-08

MORE AT TripAdvisor

Visited as was passing , food was excellent and was really enjoyable Friendly service from the waitress and owner (I think) Would recommend and a nice place for good food

site_logo

Nellyboy39 . 2020-01-03

MORE AT TripAdvisor

Second visit last night after a very good first time last month. This is a good place to eat and be well looked after-so good in fact that we've booked for Christmas dinner. See you all soon😊

site_logo

derbykinsman . 2019-11-27

MORE AT TripAdvisor

Very impressed we ordered of the £10 each set meal deal ....the starter ! We could of just had that as a main was huge ...lovely portions ,lovely flavours only issue that wasn’t an issue was the happy hardcore style of music in the background...

site_logo

442justinem . 2019-11-26

MORE AT TripAdvisor

Went with friends last night and all agreed it was the best food for miles around.The staff were friendly and attentive,the prices on a two for one deal were very affordable,including the drinks. Even the gents loo had flowers in one corner! Definitely our go-to...

site_logo

derbykinsman . 2019-10-24

MORE AT TripAdvisor

The food, service and drinks here were all simply INCREDIBLE!!! This has to be Derby's best kept secret but if you like fine Indian food you must give this place a try. Best Indian restaurant in the area by a country mile in my opinion....

site_logo

Chris G . 2019-09-29

MORE AT TripAdvisor

We collected a take away but on returning home, discovered we were missing an item that we had paid for. After calling the restaurant we were told it would be delivered, but it never showed up! Very disappointed. The food wasn't bad, not the best...

site_logo

timd2015 . 2019-08-17

MORE AT TripAdvisor

Decided to go here for dinner one evening. The food was amazing and the staff very polite and helpful. We will be recommending this restaurant to friends and coming back again!

site_logo

DannyC2590 . 2019-08-15

MORE AT TripAdvisor

First time on ordering a take away. Starter , Tandoori chicken with salad. Main course Chicken Jalfrazi. Gurka mixed grill. Pashwari Nan Chilli Nan Rice Lots of little extras. Absolutely delicious , well recommended. Shall definitely be ordering very soon. Much nicer than any of...

site_logo

Corn1515 . 2019-07-20

MORE AT TripAdvisor

We visited the Gurkha Junction restaurant again last night and again was not disappointed. It was my sons birthday and the staff made it a special evening for us all. We had provided a cake earlier in the day and after we had eaten they...

site_logo

Nigel E . 2019-07-07

MORE AT TripAdvisor

This is our third visit and we always say, we should come more often. Food is excellent and well presented and just the right amount of time in between courses. The staff were lovely and attentive. i couldn't eat all my curry and the member...

site_logo

Diane2111 . 2019-06-28

MORE AT TripAdvisor

We visited using the "meerrkat" 2 for 1 offer. Service was excellent from a very friendly and smart owner. The premises are spotless with a 5 star hygiene rating.The food could not be faulted and I was impressed with the variety of Nepalese food on...

site_logo

bob o . 2019-06-14

MORE AT TripAdvisor

Had a meal here on a school night couldn't fault it whatsoever full of flavour. Great waiter. Reasonable price.

site_logo

388granty . 2019-06-11

MORE AT TripAdvisor

Strange externally, you are welcomed immediately on entering, with a clean spacious bar area. Helpful staff show you to a table straight away - no pressure to buy drinks at the bar. What an extensive menu... Ghurkan and Nepalese foods are listed, with dairy and...

site_logo

JANET B . 2019-06-08

MORE AT TripAdvisor

Can’t praise the place enough,the food was absolutely fantastic,the staff was very polite,the restaurant was spotless and very well laid out so plenty of room,I would highly recommend a visit,I will certainly be going again.

site_logo

Dave B . 2019-06-01

MORE AT TripAdvisor

From the outside, this restaurant does not look all that prepossessing. But step inside, and you find a great little business, offering excellent service, a wide range of choices on the menu, and draught beer. Enjoy tasty Indian dishes in clean, pleasant surroundings, with attentive...

site_logo

SW6431 . 2019-05-16

MORE AT TripAdvisor

As my previous experiences of Gurkha restaurants have led me to write an excellent initial review only to be let down on subsequent visits, I decided to eat at Gurkha Junction three times before deciding to put cursor to screen. I am happy to report...

site_logo

Robin S . 2019-05-11

MORE AT TripAdvisor

Myself and my partner were pleasantly surprised after coming here. We decided as a last minute option as it is a new restaurant in the taste card range. On arrival the restaurant was smart, we were greeted by a friendly staff member who gave us...

site_logo

Benable . 2019-04-24

MORE AT TripAdvisor

We have once again visited Gurkha Junction. There is little left I can say about this place, the welcome was very pleasant, and the food never lets us down. Very tasty and satisfying. They never seem overly busy in the restaurant, but seem to do...

site_logo

ianblythman . 2019-04-08

MORE AT TripAdvisor

After being told by many people to try this place, we finally went last night. Quite easily one of the best curries I’ve ever had, brilliant polite and friendly service too, and ice cold Kingfisher on tap. Will be returning very soon!

site_logo

Alex240 . 2019-03-09

MORE AT TripAdvisor

Cracking food which is always spot on, never waivers.....slightly tatter interior, and the service could be better at times, but it’s the food that makes this place a regular destination for us...very friendly staff

site_logo

MelBrittDerbyBoy . 2019-02-12

MORE AT TripAdvisor

I eat gutkha food since couple of years with my kids and wife but when we tried to gurkha junction food we never change curry house rather then gurkha junction, food and staff wewe always brilliant, I personally highly recommend, will be vising soon again,

site_logo

Yamlal S . 2019-02-10

MORE AT TripAdvisor

This is somewhere we had been meaning to go for a while and when we finally did, we were so happy! Having never tried Gurka food before, we were happy to be guided by the waiter who made some excellent recommendations for us. The waiter...

site_logo

DottyG03 . 2019-02-09

MORE AT TripAdvisor

I never understand why this place isn't always rammed. This has got to be the best Indian/Nepalese restaurant around. Been coming here for about 8 years now, have lost count how many times but its always been spot on . Tried other restaurants (for a...

site_logo

76Foodielass . 2019-01-16

MORE AT TripAdvisor

We live a 10 minute walk away from the Gurkha Junction, and decided to eat there on Friday 28th December. What a great choice. The staff were attentive without being in your face. The food was amazing. We chose pickle tray and poppadoms to start,...

site_logo

ianblythman . 2018-12-29

MORE AT TripAdvisor

Excellent meal with some lovely vegan options. Very helpful staff who were willing to help with vegan choices on the menu. Will definitely be back.

site_logo

TraceyB187048 . 2018-12-29

MORE AT TripAdvisor

A regular place to eat out. We used to go to the Himalaya in town but it just wasn’t the same when the owner changed; we now go here. The guy that runs it is always welcoming and the food has never let us down....

site_logo

UKCoupleOverseas . 2018-12-11

MORE AT TripAdvisor

I went here a few days ago with my wife after a family friend recommended it. As soon as we arrived the service was amazing. We are Indians so we knew what to have and I looked at the menu and their are so many...

site_logo

SAGARACHARYA . 2018-12-01

MORE AT TripAdvisor

My husband and I are regular visitors this being our favourite restaurant. The food is very tasty and made fresh, and the staff are friendly and helpful. As a nut allergy sufferer the menu is easy to use to identify what is safe and staff...

site_logo

DeborahH1138 . 2018-11-22

MORE AT TripAdvisor

Great food and the staff are very welcoming. Fresh vegetables in the vegetarian dishes. We will definitely be using this as our go to curry house from now on!

site_logo

223jonathan . 2018-11-10

MORE AT TripAdvisor

I visited to this restaurant couple of time but every time I got very nice food and friendly service. Last weekend became fantastic with gurkha curry, we all family were happy and highly recommend

site_logo

Yamlal S . 2018-10-23

MORE AT TripAdvisor

Four of us went to Gurkha Junction, because we had good experiences of the restaurant in the past. It has improved since our previous visits. The restaurant has been tastefully decorated, with good lighting. The seats are comfortable with ample space between tables. The menu...

site_logo

Tony H . 2018-10-04

MORE AT TripAdvisor

Family evening out and although it was fairly quiet on a Saturday night their takeaway business seemed to be doing well. Meal for 4 with starters, sides & drinks came in a tad over £100, the food was really authentic, didn’t hold back on the...

site_logo

james_barlow . 2018-09-16

MORE AT TripAdvisor

Lovely evening out with friends. Staff were very friendly and happy. Have great advice on the menu. Nice to see some different dishes available. Food was very good. We will definitely return!

site_logo

14AmyC14 . 2018-08-10

MORE AT TripAdvisor

We were a table of 12 and all very awkward with our food and drink requests and they handled us really well. We all ate from the Set Menu. All enjoyed our starters and our mains. A lot of us are vegetarian/vegan and we all...

site_logo

elliewibb . 2018-07-30

MORE AT TripAdvisor

Been visiting this restaurant for some years now . Known as Ghurka paradise but now re named and under new management called Ghurka Junction. When it changed hands we were a bit concerned that the food quality and taste would go done hill but it...

site_logo

76Foodielass . 2018-06-07

MORE AT TripAdvisor

The food is really good great value for money Service can be slow but the food is 1st class it really is being Indian I should know. This is under NEW MANAGEMENT. You probably need to book also as does get busy. No more trips...

site_logo

Showme3 . 2018-05-31

MORE AT TripAdvisor

Me and my husband had a meal here on Saturday night. We used to go quite often when it was Ghurka paradise so we thought we would try it now it's changed. It is different, but in a good way. The food is so fresh...

site_logo

miss s . 2018-05-27

MORE AT TripAdvisor

We used to go to gurkha paradise a lot. We returned here a while ago, when it obviously had the gurkha paradise chef and it was good. Unfortunately, the past two times we have been, the curries have been quite poor. On the last occasion,...

site_logo

mjcrolla . 2018-05-26

MORE AT TripAdvisor

Excellent friendly staff and top class food. My second visit and it was lovely both times. Beautifully presented and tasty. We had the set meal which is Monday to Thursday and very good price

site_logo

janet m . 2018-04-26

MORE AT TripAdvisor

Our first visit to this restaurant after reading excellent TripAdvisor reviews. I have to say that this restaurant serves some of the nicest Indian food that I have ever tasted. With it being a multi cuisine restaurant they offer a wide selection of different dishes...

site_logo

nicholaevans68 . 2018-04-15

MORE AT TripAdvisor

I visited this restaurant last night , wow the food was so tasty it really was beautiful! Would recommend to anyone , portions were a decent size , so much to choose from, the food is so so fresh and cooked amazing. The service was...

site_logo

Rochelle S . 2018-04-08

MORE AT TripAdvisor

Gurkha junction is always my favourite Place to dine Nepalese food , Yesterday I tried set meal it was amazing .. And Recommend to give try ,

site_logo

Johnyderby . 2018-04-06

MORE AT TripAdvisor

Regularly visit this restaurant. For good reason too, food is of an excellent standard. Most curry houses offer dishes that taste all the same, not here, each dish has its own individual taste which offers a great variety for everyone to try! I’ve visited Gurkha...

site_logo

Miteymax . 2018-04-01

MORE AT TripAdvisor

This was my second visit with my friends, we really enjoyed our meals. I ordered, gurkha junction mixed grill. I absolutely love it. Service is excellent as well. My new favorite nepalese/indian restaurant. Will visit soon, keep up the good work!!

site_logo

Yamlal S . 2018-04-01

MORE AT TripAdvisor

Wet many years ago when it was a rough and ready Indian/Nepalese restaurant and thought it was pretty good. The food is now excellent, subtly different to a lot of run of the mill curry houses with imaginative and subtle spicing. The goat curry was...

site_logo

787timothyh . 2018-03-29

MORE AT TripAdvisor

First time visiting here and was pleasantly surprised. Had the set menu which is excellent value for money with great tasting food.

site_logo

19dad . 2018-03-18

MORE AT TripAdvisor

As a family we have individually visited the Gurkha restaurant in the past and it now has new owners... peoples concerns are has it changed? Yes there are a few minor changes to prices and the menu but that’s it. I booked the table for...

site_logo

ClaireLangley . 2018-01-23

MORE AT TripAdvisor

After having eaten at the previous Gurkhali restaurant that was there before,we were a bit hesitant to go as they changed the menu and ownership. Wow! How wrong were we!! The food was beautiful,tasty and spicy.The chicken and lamb was melt in the mouth,with the...

site_logo

bikerjen . 2018-01-20

MORE AT TripAdvisor

We have now visited this restaurant twice (in the same week!) and it gets better and better. The food really is amazing! We have eaten in the other Nepalese restaurants in Derby as well as many of the Indian ones, but this place wins hands...

site_logo

Lisa M . 2018-01-14

MORE AT TripAdvisor

Having been a regular of the old Gurkha Paradise, we thought we would try out the new Gurkha in the hope that it would once again become our regular favourite. We weren't disappointed, the service was excellent and not rushed to order. I had the...

site_logo

wilfredo5 . 2018-01-01

MORE AT TripAdvisor

I came to Gurkha Junction with my family and friends, when I arrived at Gurkha Junction polite waiter welcomed me to the restaurant than he offered us the table. After arriving at the place we ordered some drinks and food. We had some Gurkha beer...

site_logo

Natasha_kuio . 2017-12-28

MORE AT TripAdvisor

My friend And I have been going out every month for a curry for a while now. We have been to 5 or 6 different curry houses in and around derby. Don't know which was best this or one of the other Gurkha places in...

site_logo

John S . 2017-12-18

MORE AT TripAdvisor

Went here a few weeks ago with my other half and the food was amazing staff were very welcoming. We will definitely be going back.

site_logo

emilyhS2606CV . 2017-12-03

MORE AT TripAdvisor

Used to go to the original Gurkha paradise. The same chef seems to be there. The mo mo were excellent. The service was good but not pushy. The pickle tray was smaller but ok. The main was sea bass and was lovely not to spicy....

site_logo

vernonp0 . 2017-11-16

MORE AT TripAdvisor

Our first visit will certainly not be our last. Very friendly welcome and service. The starters were beautifully presented and tasted amazing. My starter of Nepalaya Makhamali Tikka was perfectly cooked succulent chicken, in a wonderful blend of spices was absolutely delicious. My main course,...

site_logo

Graham C . 2017-11-02

MORE AT TripAdvisor

My partner lives close by and we have always meant to visit but Saturday was the first time. Delightful in every respect: a warm welcome, helpful advice with the menu and very good food. The menu is similar in many respects to Indian restaurants you...

site_logo

David T . 2017-10-29

MORE AT TripAdvisor

We went there, for the first time, last week with friends. The interior is much nicer than the outside might suggest, but parking is very limited. The food was very good and the service was quick and friendly. We would definitely go again.

site_logo

dwm1956 . 2017-10-23

MORE AT TripAdvisor

Went to Gurkha Junction with group of 12 friends. We were greeted by lovely and friendly staff. Food was delicious I had the Chatpata Chicken with choice of Naan and my other friends had Gurkha Rifal , Hariyali Chicken. On starter we had Momo, Choyla...

site_logo

Taranat . 2017-10-21

MORE AT TripAdvisor

We have tried a few takeaways from Gurka Junction and they have all been superb. All items are well cooked and really delicious. Much better than the Indian takeaways in the area. We would recommend giving them a try, particularly the Gurka inspired recipes.

site_logo

mikevet2017 . 2017-10-13

MORE AT TripAdvisor

This restaurant is an undiscovered gem. Lovely food. Very nice people who run it. Cozy atmosphere. The only draw back is the limited parking. Gurkha food for those people who have not been in a Gurkha restaurant is a sort of a cross between Indian...

site_logo

pauldM8370IC . 2017-10-13

MORE AT TripAdvisor

What a great place with super food that reflects Nepal. The staff are friendly and they could not do enough for us. Best restaurant in Spondon by a mile.

site_logo

Kristian_12 . 2017-10-06

MORE AT TripAdvisor

We, my girlfriend and our little girl have been visiting ghurka paradise for years now and I have just started to use trip advisor and made sure that my first review would be for this fantastic little gem in spondon! We both grew up in the area and recently moved further a field but will always come back to ghurka as there is simply no other curry like it! It's so fantastic only your taste buds can describe it to you so get yourself down and try their amazing food! Absolutely lovely owners man and wife and all the staff really make you feel welcome and are a pleasure to talk to! Thank you ghurka for making my taste buds feel great, my stomach full , and most of all my girlfriend smiling when I say shall we get a ghurka tonight haha! 5 ***** just brilliant!!!!!! Thanks ghurka! Mark

site_logo

RealRealityPerson . 2016-10-15

MORE AT TripAdvisor

I thought Its time for a review as I don't really do many !!I have been coming here ever since its been called Ghurkha paradise ! The food is excellent. I love hot spicy food and I would recommend the chilli paneer for starter along with Lamb choila . I love Saag curry for main but with lots of green chilli thrown in for good measures!! Give it a try !All the staff are great especially the owners Rommi and his wife .A big thank you for making my birthday meal the best every last week too!!

site_logo

BARRY M . 2015-11-15

MORE AT TripAdvisor

Visited today after a workmate told us we must try gurkha paradise..I can honestly say it's definitely made it into my top 3 of curries..we will be back soon!

site_logo

Tom B . 2015-11-01

MORE AT TripAdvisor

We went to this restaurant on a Thursday evening and it was very quiet, in fact, i think we were the only people in there for the majority of the meal. This was funny because the food was brillaint and the service very good, perhaps we were just lucky, this meant the food was quick and we had a wonderful meal with a nice restaurant all to ourselves. The place looks like it was decorated recently so its all very nice inside, there is plenty of parking around the back too, so great for a rip from a little further a field. overall, highly recommended.

site_logo

Paul W . 2015-10-30

MORE AT TripAdvisor

2nd time around and still as good as ever the food is great and the drinks are very reasonable priced and service by nice people will definitely be going there again

site_logo

SOMELIKEITHOT47 . 2015-10-29

MORE AT TripAdvisor

My husband and I have visited a lot of Indian and Gurkha restaurants in the Derby and Notting ham area. There are some very good ones, but not many as good as this one. It's not the smartest, but it's family run and you always get a warm welcome and great service. The food, especially if you try the Gurkha specialities is excellent - fresh and tasty I love the Chicken Sagamartha. We've recommended it to quite a few people and they've invariably agreed with us, and gone back again.

site_logo

kajacr0 . 2015-10-28

MORE AT TripAdvisor

Similary restaurants in East Midlands

restaurant_img
4.5

722 Opinions

location-icon42 Chapel Street, Spondon
Asian
outdoor_seating_163832takeaway_163832delivery_163832

Delicious food, best curry around. The staff are excellent. We will definitely be back. Thank you

restaurant_img
4.5

645 Opinions

location-icon
Asian
outdoor_seating_189869takeaway_189869delivery_189869

Very nice place.foods excellent.we are happy to celebrate my wedding anniversary there with delicious food .

restaurant_img
4.4

1259 Opinions

location-iconLondon Road
Asian
outdoor_seating_166499takeaway_166499delivery_166499

Fabulous meal always and excellent staff

restaurant_img
4.4

462 Opinions

location-icon174 Portland Street
Asian
outdoor_seating_163801takeaway_163801delivery_163801

The food is amazing, best curry I've ever had!

restaurant_img
4.6

2290 Opinions

location-icon80 Macklin St
Asian
outdoor_seating_166561takeaway_166561delivery_166561

Fantastic food with a slight twist to the regular Indian restaurants. Well worth trying the alternative dishes, very tasty.