GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
3.7

Based on 2.617 opinions finded in 3 websites

site_photo4

Nº 677 in 921 in Trafford

Nº 25 of 36 Chinese in Trafford

CUSTOMERS TALK ABOUT DISHES WITH..ricecookedribsfishfriedprawnpepperchickenladycurry

comment_iconOpinions

Great chippy, been goin 20yrs, however card payments would be good

site_logo

mark ditton . 2025-03-26

MORE AT Google

By far the best delivery driver I’ve had, for some reason my address was incorrect on the order and my fault for not checking, but the driver phoned me and dropped my order to my actual address, no questions asked no complaints, thank you so much

site_logo

James . 2025-03-21

MORE AT Just Eat

Gone down hills seems unclean and unhygienic. Been a few times and it gets worse each time. The lady is quite rude aswell she doesn't listen when you order or ask for salt and vinager. Each time she ignored the fact I asked for salt n vinegar. Sausages was dry have my child ulcers on their tounge. Chips are dripping with grease. And the gravy just tasted weird and lumpy with perfume taste. It was a waste of money and it all got slung in the bin. NEVER AGAIN ROBBED!!

site_logo

Shannon W . 2025-03-10

MORE AT Google

Staff was rushing and not friendly. Food is OK but very small portions.

site_logo

maria graham . 2025-03-09

MORE AT Google

Amazing food as always - such good value and the delivery driver is always so friendly - would highly recommend this Chinese takeout

site_logo

Harriet . 2025-03-07

MORE AT Just Eat

I'm a repeat customer, my favourite is Special Vermicelli. I've never been disappointed in over 2 years.

site_logo

Cosmin . 2025-02-25

MORE AT Google

Chips and gravy with no gravy as it had all tipped out child with autism annoyed and rest of order covered in gravy

site_logo

Kerri . 2025-02-22

MORE AT Just Eat

Just to bring too people's attention i attention from there last week the chips was like they were from sedricks garage boundary lane and the young lady serving me looked like she just done my breaks on my motor if you think I'm being rude you check there overalls thanks hulme man,

site_logo

Shirena Depasois . 2025-02-16

MORE AT Google

Love the food always brought food up too us apart from tonight when we had too go and get it.why are we paying delivery if they don’t deliver too the door

site_logo

Jillian . 2025-02-14

MORE AT Just Eat

I've been ordering from Gar Pan for a few years now. Recently, the food has become very onion and carrot heavy, with the protein reducing. The food is good, though a little salty.

site_logo

Rob . 2025-02-13

MORE AT Just Eat

Absolutely beautiful. Cooked fresh. Very tasty🥰

site_logo

Mary . 2025-02-08

MORE AT Just Eat

food was cold driver didn't have order in a thermal bag

site_logo

Brad . 2025-02-08

MORE AT Just Eat

cold food. Would have been lovely if it was hot. Hate cold food.

site_logo

chrissy . 2025-02-02

MORE AT Just Eat

Food came stone cold. Wasn’t even barely warm. Called them and they wasn’t interested. Asked them if I bring it will they replace it and they said no contact just eat and get a refund we’re busy. Absolutly shocking service and to top it off just eat wouldn’t do anything about it either.

site_logo

Paul . 2025-02-02

MORE AT Just Eat

Been going here since the 80's when i lived nearby, so was buzzing when i found them on juat eat food is always brilliant

site_logo

Pete . 2025-01-30

MORE AT Just Eat

Food is excellent but live delivery tracking would improve my order

site_logo

Kurtis . 2025-01-20

MORE AT Just Eat

Missing salt and pepper chips. Had to collect myself. Then charged me for a collection on altrrnative order. Disapointing.

site_logo

Samuel . 2025-01-18

MORE AT Just Eat

staff was not the best. asked re. prawn crackers given most places will give once you've spent over £20... I spent over £25... staff said no to prawns crackers and then started speaking in chinese which I'm guessing they were flagging me off!!!! poor customer service and experience! Will not be recommending or returning! Thanks but it's a no from me!

site_logo

Jay . 2025-01-04

MORE AT Just Eat

Food is absolutely superb from here and I mean that but the spring roll I ordered was all stuck to the paper. It ended up a mess of bean sprouts and small nuggets of chicken needing a fork!! Not good

site_logo

Julie Mcaughtrie . 2025-01-03

MORE AT Google

For an order worth £50, you would expect prawn crackers and a bottle of drink to be thrown in at least, especially as the order took over an hour to deliver.

site_logo

Lily . 2025-01-01

MORE AT Just Eat

Another saturday night feast fantastic food great servce and good prices Well done yet again gar pan have a great year ahead 👍

site_logo

William . 2024-12-28

MORE AT Just Eat

Garpan has been my got to for a while now ..they have quality food that are tasty and with good portions

site_logo

Oye . 2024-12-26

MORE AT Just Eat

Lovely food, just arrived late due to volume of traffic

site_logo

Beverly . 2024-12-14

MORE AT Just Eat

Beef curry, salt & pepper chips are amazing

site_logo

Kevin Gordon . 2024-12-08

MORE AT Google

Giving 5 stars because they’re one of the few Chinese chippys that do real chippy chips!!

site_logo

Jamie . 2024-12-06

MORE AT Just Eat

Lovely staff great food think most of the food is delivered

site_logo

john mclean . 2024-12-06

MORE AT Google

All the food was cold! It’s a ten minute journey and it took 40 minutes! No apology nothing

site_logo

Jo . 2024-12-06

MORE AT Just Eat

lreally enjoyed the food and will be ordering in the near future🙂

site_logo

Elizabeth . 2024-12-02

MORE AT Just Eat

Order from here often, usually spot on. However, they seemed to have changed the shredded chicken from thin crispy pieces to chicken strips (please change it back!). Either way, I would recommend, as the portion sizes are great & the salt & pepper dishes are amazing!

site_logo

aimee . 2024-11-30

MORE AT Just Eat

very late , brutal communication.

site_logo

Rob . 2024-11-18

MORE AT Just Eat

Sadly my food is only luke warm.. I understand there is a match on ! But I thought you deliver in a heated bag

site_logo

Dave . 2024-11-07

MORE AT Just Eat

Great food, have ordered multiple times and I’m never disappointed

site_logo

Maria . 2024-11-06

MORE AT Just Eat

Found what looks like part of a pen in my fish and chips put me of my food

site_logo

Diane . 2024-11-04

MORE AT Just Eat

Gar Pan To date are on point regarding taste an quality of food per portions Which is above an beyond what you pay for for any occasion I hope they dont change Cause Its 1st time I'm biggin up any establishment ❤

site_logo

Millicent . 2024-11-03

MORE AT Just Eat

Waiting 1 hour 30 minutes for my order to arrive as I am writing this review I am disgusted with how they lie and tell you your order on the way when it clearly isn't

site_logo

Angela Lenihan . 2024-10-27

MORE AT Google

Great food! Order from here a lot as the quality and portion sizes are fantastic. Unfortunately, this time the chips were soggy :(. My order was out for delivery for over 35 minutes which explains it (please don’t do this again guys!). Even so, would definitely recommend.

site_logo

aimee . 2024-10-27

MORE AT Just Eat

Our food was delivered missing 2 portions of fried rice. When we called, they offered to ‘give it us next time’ which we couldn’t do as it was the main part of our dishes. Agreed to redeliver and if it was going to be ‘a long time’ to replace the food which we were fine with. Delivery was an additional 50 minutes and they just delivered the rice. Really unhappy! Our food is now soggy, cold and inedible. We always order from here, but tonight was beyond disappointing. Waste of £50.

site_logo

aimee . 2024-10-27

MORE AT Just Eat

One of the best chineses i have had in a while. Really enjoyed every bite.

site_logo

Samuel . 2024-10-22

MORE AT Just Eat

The food took 2 hours to arrive after I placed my order then the food was nearly cold when it arrived I’m very surprised as I order frequently from Garpan and it’s never happened before

site_logo

Lisa . 2024-10-11

MORE AT Just Eat

Always loved Gar Pan from years ago. Great tasting...Great portions could never finish...absolutely A****

site_logo

Jay . 2024-10-11

MORE AT Just Eat

variety was good and all of it was nice

site_logo

Calvin . 2024-10-01

MORE AT Just Eat

Great food, great delivery time

site_logo

Josef . 2024-09-29

MORE AT Just Eat

Amazing! Food was incredibly fresh and tasty.

site_logo

aimee . 2024-09-28

MORE AT Just Eat

Food really tasty & incredibly fresh! These guys always listen to special requests.

site_logo

aimee . 2024-09-21

MORE AT Just Eat

Flopped off since their mom and dad left.

site_logo

kher landa . 2024-09-20

MORE AT Google

Highly recommend best takeaway on just eat by far, food always beautiful

site_logo

Pete . 2024-09-14

MORE AT Just Eat

Absolutely stunning food. We all really enjoyed it. Thank you.

site_logo

Caroline . 2024-09-13

MORE AT Just Eat

I placed the order at 19:33 and it arrived at my home at 21:20, with items missing and what did arrive was disgusting and went in the bin. The driver practically threw the food at me and couldn’t get away quick enough

site_logo

Steve . 2024-09-13

MORE AT Just Eat

lovely tasting for I can highly recommend the prawn toast

site_logo

paul . 2024-09-11

MORE AT Just Eat

Amazing as always and super quick

site_logo

Neil . 2024-09-09

MORE AT Just Eat

Missed you being closed last week. Food as usual delicious and hot

site_logo

Sayennah . 2024-09-05

MORE AT Just Eat

This Chinese takeaway is one of the best 👌 I tried from different places but nothing beats GarPan.

site_logo

Brîndusa . 2024-09-05

MORE AT Just Eat

Fantastic service, great food, large servings. Delivery always good to.

site_logo

Rob . 2024-08-11

MORE AT Just Eat

Great food & portion sizes. Always listen to special requests. Would highly recommend this Chinese - it’s the best in the area. Try it! You won’t be disappointed.

site_logo

aimee . 2024-07-28

MORE AT Just Eat

lovely food and the food was lovely and hot, delivery person was very nice, thank you

site_logo

Jennifer . 2024-07-23

MORE AT Just Eat

Special chow mien was best I’ve had and I’ve had a lot x just believe me on this x

site_logo

P Keogh K . 2024-07-21

MORE AT Google

After complaining about the food being soggy, this order arrived perfect! The portion sizes are great, the food tastes amazing and special requests are always listened to. We LOVE this Chinese - try it, you will too!

site_logo

aimee . 2024-07-19

MORE AT Just Eat

Very tasty and generous portions

site_logo

Ian . 2024-07-18

MORE AT Just Eat

Food was tasty as always! However, it must have been in the delivery bag for too long as the chips & salt and pepper chicken was soggy. We always order from here and it’s normally perfect - please make sure this doesn’t happen again, guys! Would still 100% recommend.

site_logo

aimee . 2024-07-13

MORE AT Just Eat

Just ordered special fried rice & sweet & sour chicken. Delicious! Rice was packed with meat & prawns, sweet & sour so fresh & tasty

site_logo

Hayley Thomas . 2024-07-12

MORE AT Google

Best salt and pepper munch box

site_logo

Danielle . 2024-07-11

MORE AT Just Eat

Great Chinese! We’ve tried a wide range of dishes and they’ve all been fantastic. The team at Gar Pan always listen to our special requests too. Try it, you won’t be disappointed!

site_logo

aimee . 2024-07-01

MORE AT Just Eat

Definitely my favourite Chinese in the area (And we’ve tried loads!). Portion sizes are fantastic for the price & the food tastes great. Would definitely recommend!

site_logo

aimee . 2024-07-01

MORE AT Just Eat

This salt pepper chicken wings are so good u will definitely be coming back for more I have never had anything like this and the salt pepper squid is also so good and I guarantee that everything else will be such as good Edit : The food is amazing as always, literally always fills you up and is so well seasoned and flavourful, better then most fancy Chinese restaurants I've been too. I don't trust anyone who doesn't love gar pan SO DAMN GOOD. TO DIE FOR.

site_logo

cloud kixi . 2024-06-30

MORE AT Google

LOVE this Chinese. We order more than I’d like to admit. The Salt & Pepper dishes & sweet crispy chilli chicken are fantastic. Proper ‘chippy chips’ too!

site_logo

aimee . 2024-06-21

MORE AT Just Eat

Great food with lots of fresh vegs, affordable price and nice staff!

site_logo

Ann L . 2024-06-09

MORE AT Google

Chips were hard and tasted of old oil. Probably reheated. Told my family to avoid the place.

site_logo

Ryu Landa . 2024-06-02

MORE AT Google

Food was amazing portion size well worth it 👏🏾👏🏾👏🏾👏🏾

site_logo

Simone . 2024-05-13

MORE AT Just Eat

Iam amazed at the way this restaurant works as it’s a lovely family owned business that has great customer service, fast and efficient delivery they make sure the food they make is with love and has fascinating taste that will make sure you enjoy every last bite of it and may I also add that the lady who works at the front is a great and friendly person that I look forward too seeing everytime I go to get food.

site_logo

Kawa Muhammad . 2024-05-13

MORE AT Google

food really good as usual excellent delivery recommend Singapore vermicelli salt and pepper chips

site_logo

Tracy . 2024-05-12

MORE AT Just Eat

Do not order food from this grease ball or a takeaway. Chinese people are not clean they don't burn the hair of the chicken wings and the meats dirty and black inside. No vinegar no lemon. All the salt and pepper dishes come soggy and salty way to much oil. I use to really like this place but after eating from other chinese. It's disgusting. Spend else where.

site_logo

Delvino D . 2024-05-12

MORE AT Google

Delivered before expected time but the chips were naff and wasn’t hot

site_logo

Nicola . 2024-05-11

MORE AT Just Eat

Always great food at a reasonable price

site_logo

Gary Doyle . 2024-05-09

MORE AT Google

Food hasn’t arrived. Restaurant extremely unhelpful

site_logo

clair . 2024-05-06

MORE AT Just Eat

food great, however idiot driver went to wrong house who then stole it, contacted gar pan who replaced order very quickly, how driver could get wrong house is odd, correct address, instruction added to go to side door, gate would be open our house number is on both gate posts, it is in 7 inch high black numbers on the white porch, it is in foot high numbers on 4x wheelie bins, it was daylight - so why go next door who have no side door and no clearly visible numbers and then give meal to small child - best advice is collect

site_logo

Karl Cordingley . 2024-04-29

MORE AT Google

The fish and chips were great. Fish was crispy. The curry sauce was really good too!

site_logo

Dan . 2024-04-26

MORE AT Just Eat

fantastic customer service great food and excellent value for money.

site_logo

Darren . 2024-04-22

MORE AT Just Eat

I always order from here. fish perfect. chips where a bit too hard.

site_logo

Delroy . 2024-04-19

MORE AT Just Eat

Best fish and chips in Manchester…if not the world!!!

site_logo

Caroline Ashworth . 2024-04-18

MORE AT Google

Made me spend more money and make me wait for nearly 2 and lied and said its been delivered. I want my money back. IV been loyal to this take away. NO MORE

site_logo

James . 2024-04-15

MORE AT Just Eat

The food has not been delivered.

site_logo

Michael . 2024-04-11

MORE AT Just Eat

Good quality food. Same old selection 😴

site_logo

Robin Aust . 2024-04-09

MORE AT Google

They don't care. People will keep walking through the door, regardless.

site_logo

gerhardt muller . 2024-04-09

MORE AT Google

Great taste, great portions, value for money and early! will be back

site_logo

Euan . 2024-04-08

MORE AT Just Eat

Amazing restaurant, food is always fantastically cooked & freshly made. Absolutely delicious 😋 more than highly recommended.

site_logo

Chez . 2024-04-05

MORE AT Google

Delivery didn't arrive in time frame and I had to wait an extra time

site_logo

jacqueline . 2024-04-03

MORE AT Just Eat

Tried this place for the first time! Very happy with the portion size! It was nice and hot when I got it and very delicious 🤤 I wasn’t very keen on the pork spring roll but everything else was lovely 🥰 chicken fried rice was very tasty and my sweet and sour chicken was very good too I would definitely recommend this place.

site_logo

Jennifer . 2024-03-30

MORE AT Just Eat

The best Chinese takeaway in Manchester. The food was amazing and delicious, good quality, fresh and hot . The staff’s are very friendly and helpful. Delivery very fast .

site_logo

Abdulllah Gharib . 2024-03-29

MORE AT Google

I've always enjoyed the food and theirs lots of it , nice enough peeps if ya go in . But there delivery driver always brings cold chips , So go and get it yourself and the chippy fine .

site_logo

D Coco . 2024-03-28

MORE AT Google

Food is amazing here, I’ve been coming to Gar pan since I was a kid

site_logo

Naomi . 2024-03-25

MORE AT Just Eat

If you want food poisoning.. visit here. I'm unsure how they have been able to stay open for such a long time Rats and many other health and safety concerns... I give 1 star reviews to dirty places that give food poisoning, poor customer services also But give many 5 star reviews to those who deserve it. Gar pan needs to be shut down permanently

site_logo

c amore . 2024-03-25

MORE AT Google

Gar Pan has always been a great place. I agree that recently, it's been a little down. I was disappointed this evening when I received a dodgy chop suey roll, which I get regularly it tasted disgusting and was no meat inside. The portions are getting smaller, and the chips are cold and dry. Sorry Dan! 😞

site_logo

Sharon fiddy . 2024-03-23

MORE AT Google

The food is always good. The bbq ribs are seriously amazing.

site_logo

Rick Page . 2024-03-19

MORE AT Google

The salt and pepper chips were disappointing, not very nice at all!

site_logo

Yvette . 2024-03-08

MORE AT Just Eat

Absolutely great food, I really can't fault them, now I travelled from burnage to go there it has got to be the number 1 for Chinese take away , please just try, they do allsorts to please everyone, everything is fresh and cooked properly

site_logo

riowilson . 2024-03-07

MORE AT Google

Been a regular for years always enjoyed the food but since this year it's gone down in my book. Just ordered King Prawn fried rice. I got about 7 undercooked prawns in the whole dish. They were soft and gooy. Rice wasn't nice and not much flavour with bits getting stuck in the throat. Shame!

site_logo

Giorgio Zappone . 2024-02-27

MORE AT Google

Fantastic service and excellent food great value for money but the atmosphere is a bit dull.

site_logo

Darren Lee Dodd . 2024-02-27

MORE AT Google

Kung po tofu was absolutely banging, I could eat it every day and not get bored.

site_logo

Lucy . 2024-02-25

MORE AT Just Eat

The food was really nice and fresh, if you’re local do collection to avoid long wait times for delivery

site_logo

Connor . 2024-02-24

MORE AT Just Eat

As usual special fried rice and salt and pepper BBQ ribs were warm, plentiful and delicious

site_logo

Sayennah . 2024-02-14

MORE AT Just Eat

Similary restaurants in North West

restaurant_img
3.8

1400 Opinions

location-icon24 Cross Street
Chinese
outdoor_seating_113900takeaway_113900delivery_113900

Brilliant takeaway you should definitely try. Food is delicious 😋

restaurant_img
3.5

1078 Opinions

location-icon91 Washway Road
Chinese
outdoor_seating_114038takeaway_114038delivery_114038

Ordered a Takeaway, best Chinese I’ve had in years. Def recommend!

restaurant_img
3.8

142 Opinions

location-iconBarton Road
Chinese
outdoor_seating_196400takeaway_196400delivery_196400

Popped in a couple of Sundays ago. Great full English with a mug of tea. Nice friendly owner. Just what we needed after travelling for an event. Set us up for the day.

restaurant_img
3.5

9 Opinions

location-icon12 Brooklands Road
Chinese
outdoor_seating_236391takeaway_236391delivery_236391

Food is fresh and cooked with low msg and overall very very healthy. Best BBQ ribs in Manchester- fact. And also salt and pepper tofu is absolutely spot on. Health Chinese????? Absolutely the best one in Manchester. How do I know?....because I was the choy Hing village....well done kens kitchen better than China town

restaurant_img
3.9

185 Opinions

location-icon237 Talbot Rd
Chinese
outdoor_seating_83930takeaway_83930delivery_83930

Delicious veg curry and veg chow mein with crispy seaweed. Arrived on time and really hot. Thank you. Will use you again.