Based on 684 opinions finded in 2 websites
Based on 684 opinions finded in 2 websites
Opinions
Had a quick dinner last night with the wife and the boys and everything was perfect. Thank You.
Gent Bego . 2024-03-14
MORE AT Google
Nice to see the restaurant open again. Unfortunately our recent meal wasn't the finest we've enjoyed but I'm confident this was a blip and we will certainly return and order different dishes next time.
Celia Bee . 2024-03-09
MORE AT Google
Lovely spot for some fresh authentic Italian food. Had the bruchetta pizza starter, which was spot on. The seafood marinara was packed with flavour, and the pasta was cooked to perfection. The homemade tiramisu was a great way to end it. Would definitely recommend
Tim G . 2024-03-05
MORE AT Google
Really tasty food, though let down by poor service from inexperienced staff and atmosphere with tables too close together.
Mark Jenkins . 2024-02-24
MORE AT Google
Fantastic food every time. Cannot rate this restaurant highly enough. The staff/owners are always so friendly. Would recommend to anyone!
Adam Skinner . 2024-02-14
MORE AT Google
Lovely local italian bistro - delicious pasta and seafood, the truffle pasta in particular was excellent. Great service and atmosphere, lots of buzzy tables of folks enjoying their dinner - if you fancy some italian food, a far better choice than any of the usual chains.
Kenneth Greene . 2024-02-01
MORE AT Google
One of the best independent restaurants in Balham!
Cala Leila . 2024-01-29
MORE AT Google
My son and his girlfriend are regular visitors at this wonderful restaurant . We went on a Sunday afternoon and the place was busy and full of atmosphere . We all had different dishes and they were all unbelievably tasty . The owner Giuseppe was a great host with a lovely warm and friendly personality. I can't wait to go back and try more dishes . I shared a tomato pizza and a garlic pizza to start with, followed by seafood pasta and finally a delicious pantone and butter pudding with vanilla ice-cream. This is definitely the best Italian restaurant I've been to in years. Thank you Giuseppe for putting quality food in our stomachs !!
Delia Ramsden . 2024-01-22
MORE AT Google
My friend and I had a wonderful evening at Ciullosteria. The food was authentic and delicious and the service was excellent. Highly recommend
Julia Janks . 2024-01-09
MORE AT Google
I was here for a late dinner on New Year's Eve with family and friends. The atmosphere was buzzing and the music was playing...everyone was enjoying themselves. As there were 5 of us, we decided to share some starters (all £13+ each). We went for the tagliere misto (mixed cold cuts), il culatello (cured rear leg of ham) with mascarpone and torta fritta, and the calamari fritti. The cold cuts were all good (but that's a given in an Italian establishment), including the parma ham, salami, and lonza, but especially the mortadella as it was very flavoursome! The culatello was very good too, and went very well with the mascarpone spread on the fried pizza. Finally, the calamari...the batter was lovely and crispy, and the squid not chewy, but they were too salty, and that let them down! :( For my main, I decided to go for the sirloin steak with wild musroon sauce and Italian style roast potatoes. The spuds weren't too bad, but they were just boiled and quickly sautéed to crisp them up...I could of done with a few more. The steak itself (cooked medium rare) was chewy and completely tasteless! If you'd tried this blindfolded, you wouldn't have known it was beef, and the wild mushroom sauce didn't really help cover it up. I was looking forward to it, but it was a bit of a letdown. So, it was definitely not worth the £22 paid. As it was NYE, there was a different menú and there was no pizza that evening, which is what I would have chosen over the steak. Prices were also higher on the menú because it was the last day of the year. Service was fine...friendly and not too imposing. Only 3 stars as I was let down on the calamari and my main, and the fact there wasn't any pizza available. I'd pop back to try the pizza and give my verdict on that part of the menú. Worth a visit if you like run-of-the-mill Italian cuisine, as they have most of the usual suspects on the menú here.
Matthew Aleandri . 2024-01-06
MORE AT Google
Great to see this lovely restaurant open again after the dreadful fire. The wonderful team fitted us in at 9.15 last night and the place was packed. Great fresh pasta with truffles and my partner had pasta with clams. Quick efficient service, the refurb looks a great - nice homely atmosphere.
Susan Cellan jones . 2023-11-10
MORE AT Google
This pasta was superb! Went for the SPAGHETTI ALLA MARINARA which was genuinely exquisite. The setting was lovely and cosy and service was friendly, prompt, and attentive. Will definitely return
Zahida F . 2023-02-03
MORE AT Google
We have visited this restaurant before and it was very good, but this time it was quite ghastly. I always write an honest review, so it is hoped that this place will take this one on board. We were near the front, so we were all freezing. Keeping a coat on helped, but in the end we were all happy to go home for a warm drink. Be careful of the food. I had seafood pasta, which had a good helping of seashells, the vast majority of which were empty. This is an easy dish to "recycle"... My daughter's food never did arrive, so they graciously agreed not to charge us for it. Give them credit - they gave us a free bottle of wine as an apology. I really wish I could say something good, but cannot.
Driver_in_Europe . 2023-01-25
MORE AT TripAdvisor
Amazing scallop starter - all the starters were soo good! Slightly slow service, hence the 4 stars - lovely restaurant though!
Ellen Roberts . 2023-01-20
MORE AT Google
Always busy, always delicious, and always authentic. Italian family through and through for years, and a legend in Balham. Definitely book in advance.
Charlotte Willis . 2023-01-19
MORE AT Google
Staff were friendly, chairs uncomfortable, wine indifferent and my food tasted like cat food smells.
Helen Rennie-Smith . 2022-12-14
MORE AT Google
Proper Italian restaurant with very good service and great food. Perfect for a romantic dinner and with a great atmosphere. Usually packed full so best to book ahead of time.
Adam R . 2022-12-02
MORE AT Google
Delicious and generous portions , lovely staff , nice atmosphere!! Absolutely loved that place and will be visiting often !!!! Highly recommend!!!
Yuliya Yotova . 2022-11-26
MORE AT Google
Great Italian food delivered with care and by attentive staff who take pride in their craft. Atmosphere is intimate but lively and children are welcomed.
Mary Orr . 2022-11-24
MORE AT Google
After reading the reviews, I was really excited to try this restaurant, but I’m really disappointed in its takeaway. The clam pasta was over cooked and dry. The sauce was too acidic with additional sand. The margaritas pizza was just below average with burnt basil on top. I was expecting more.
Mingjane Chen . 2022-11-16
MORE AT Google
We went for my friends hen do meal and the service was fantastic. Lovely atmosphere, food and wine delicious
Jess Stapleton . 2022-11-11
MORE AT Google
This Italian is the best in London in my opinion - I have been here several times and shall continue to come here as long as it stays the way it is. Food is faultless, drinks are lovely, staff are friendly and attentive Authentic Italian without the bravado Cannot fault it is easily one of my top 3 restaurants in London, not just Italian. So reasonably priced for the quality of food and service and ambience Make sure you book as it gets busy on weekends! See you soon Faith x
faithe938 . 2022-11-06
MORE AT TripAdvisor
One of my favourite local restaurants in SW London. Fantastic food and the staff are always welcoming and friendly. A great place whatever the occasion
Jessica Boshier . 2022-11-02
MORE AT Google
Excellent Italian family run restaurant. Very friendly, good ambience first class food.
Gerry O'Connor . 2022-10-23
MORE AT Google
We have lived in Balham for over 5 years and we only came across this restaurant very recently, it’s our new favourite - so much so that we went twice in a week. The food is excellent, the service is good, the wines are lovely and it has a great ambience. For the quality, the prices are very reasonable. We always thought Balham lacked a lovely local Italian restaurant - turns out it had an excellent one all along!
tracylondon . 2022-10-22
MORE AT TripAdvisor
We managed to book an early table with Ciullosteria on the day we visited (we were lucky as later saw others being turned away!) a local restaurant we’d passed by many a time, but hadn’t tried yet. The owners were really friendly and I loved the ambience and vibe in the restaurant, relaxed and a bit retro in deco but so intimate and cosy! The starter portions were plentiful, maybe lacking a little on actual presentation but who cares when the food tastes so good! My parpadelle with beef ragu was simply delicious! It came out fresh, piping hot and so yummy…I would definitely go back and eat it again! The house Tiramisu was to die for! Absolute perfection 😋 Surprisingly good value for money for all the food we had. Highly recommend.
Parveen Naujeer . 2022-10-08
MORE AT Google
We sat down at 730pm and didn't get our mains until 9pm (having had a starter). The food was delicious but very slow. Apparently the second chef had not turned up for work, but there was no communication of this until the mains arrived. If this is the case you should tell people at the start of the meal that the food will take a long time, so they can adjust their expectations or go elsewhere.
Omar . 2022-10-04
MORE AT Google
Guess what, it's the best birthday in the world, the real GOAT is celebrating both his first year has a divorced man, and also his first year after being 30 years old We went to an Italian place, I though the lucky Impulsiva was coming but this time he came with a new one, Amisha, I thought it was an Amish in a female version, but that was really her name. The Best is playing russian roulette, if I might saying russian at a time like this, bringing a new girl everytime we meet. The environment looked pretty nice, we ordered very good antipasti, good attention from the staff, but then Picky Boy said "The lightning is bad, The air conditioning is full of flies, too much noise, I need my earplugs" We waited and waited for the food, at some some the Impulse said "Where's my food? Do I need to go to the kitchen and make it myself? I need my protein, I need to grow" When The future King of England asked him for our food, the waiter gives up on his job and immediately pours himself a glass of wine and drinks a penalty. Food arrived, they even gave us a free salad to apologise, nice gesture, and sang happy birthday to Pedro with a very nice presentation, lovely lovely lovely! Overall it was a very good experience, The Avenger was happy, almost smiling, since we know he doesn't like surprises, but the restaurant loved to have him there.
António Ribeiro Lima . 2022-10-01
MORE AT Google
Went for a late lunch and was unable to order my first 2 choices for main course due to them being unavailable. My 3rd choice a Seafood Pasta (£17) turned up with 1 Prawn, 8-10 mussels 25% of which were empty and the rest looked very sorry for themselves, 2 or 3 small bits of rubbery octopus and a couple of other unidentifiable ingredients. Oh and a few pathetic cockles. Just a desperately sorry attempt for a heartwarming plate of food. I would've sent it back initially but i was with a large group of people.
Matt MacDonald . 2022-09-11
MORE AT Google
superb pasta, and decent wine list. Not especially cheap, but good value for what you get.
Paul Williams . 2022-09-02
MORE AT Google
Vero vero vero good! Tutto veramente ottimo: l'ambiente, il servizio e la cucina. 10 e lode....anche il prezzo è ottimo
Mimma Margherita Girino . 2022-08-22
MORE AT Google
Perfect italian taste, friendly service, onest prices. I love Ciullosteria!!!
Paola Macchi . 2022-08-13
MORE AT Google
Amazing food and great customer service.
Omar Omar . 2022-08-12
MORE AT Google
Excellent food, friendly staff. Nice buzz to the place. Definitely book a table.
Nick Staib . 2022-08-07
MORE AT Google
Food is ok, nothing great. Service was good. I had seabass that came on a bed of oil (and not olive oil). Vegetables were almost raw and tasteless. My friend has pasta and he wasn’t pleasantly surprised. Not sure about pizza.
Caroline Carvalho . 2022-08-05
MORE AT Google
I have visited this restaurant several times and been very satisfied, however this evening my partner and I were extremely disappointed with the quality of the food. The owner was waiting on the tables and when I mentioned my disappointment appointment he was extremely dismissive, funnily henste have
Wilfred Coutto . 2022-07-25
MORE AT Google
We had a delicious dinner here this evening as guests of a very old friend of ours. An amazing evening and we will be back
Elise Ritchie . 2022-07-23
MORE AT Google
Really good food, really good service, really very good all round. Had three courses. Starter was very generous in portion size, main course was similar (had to box it up to take home) and the dessert was great. All of the waiters and waitresses were fantastic and very friendly. Will definitely be going again.
Jock-75London . 2022-07-20
MORE AT TripAdvisor
Lovely place if a bit small. Big, well made portions and good service with a nice wine list too. Though my spaghetti alle vongole had lots of grit in it. The other thing is that they didn't clean our table/change our tablecloth before we sat down which wasn't so nice, but I guess we went on a weekend.
Samarth Kanal . 2022-07-19
MORE AT Google
The tiramisu is one of the best desserts I've ever had
Matthew Rowell . 2022-07-17
MORE AT Google
Fantastic food and brilliant service! We had the pesto ravioli, ravioli mascarpone, and the spaghetti vongole. It was all delicious. Also reasonably priced and excellent service. Would highly recommend
Daniel Shrage . 2022-07-13
MORE AT Google
What an absolutely fantastic restaurant. The food is outstanding. The atmosphere is perfect. And the owners are just fabulous! I have been to many Italian restaurants across the city and I think I have just found my new favourite spot. I can not recommend this restaurant more. Balham’s best kept secret.
Fleur Fuller . 2022-07-10
MORE AT Google
Have not found a better Italian restaurant in this class. Superb . Decent price , great staff and superb food. An all time favourite . Just brilliant. Homemade seafood pasta is the nuts
Iowtraveller1 . 2022-07-02
MORE AT TripAdvisor
This is the best Italian restaurant in Balham it was amazing! The food was brilliant and the staff were very attentive. We had a party of 4, I booked the table last minute. Considering we all had alcohol drinks the cost was very reasonable.
Beverley . 2022-06-23
MORE AT Google
Excellent Italian food ! Very cosy and good service . Really recommend .
Ms Raymundo . 2022-06-21
MORE AT Google
Very very good, bruscetta was so fresh and lobster pasta was divine. Has a really pleasant authentic feel and decent wines too
Thomas Gadd . 2022-06-18
MORE AT Google
Incredibly friendly staff, delicious food and wine nothing was too much trouble even when I booked the wrong night with wrong amount of people ! We will definitely go back and highly recommend
Amelia Lowe . 2022-06-12
MORE AT Google
All ingredients fresh that day. One of the best Balham restaurants thanks to the authenticity and variation in the menu. Very chatty and pleasant owner. Will be back
GrandTour31844037832 . 2022-06-10
MORE AT TripAdvisor
Flower plants, indoor plants collections are very nice.
Anjana Patel . 2022-05-20
MORE AT Google
Love love love it here !!!!! Food was amazing and the staff are so friendly. Must go to in Balham
lucy davies . 2022-05-11
MORE AT Google
Came here for a surprise party with all my mates Food was 20/10 best Italian I’ve had for a very long time and the staff are super super nice Came back next day with my parents 100% recommend
samuelbJ6540XU . 2022-04-21
MORE AT TripAdvisor
Staff are always so lovely, food is always fresh and delicious. Best Italian in Balham by far! The seafood pasta is amazing, and very generous portion. Calzone great too. We’ve been quite a few times now and everything we have tried has been amazing.
Curious589925 . 2022-04-08
MORE AT TripAdvisor
Staff are always so lovely, food is always fresh and delicious. Best Italian in Balham by far! The seafood pasta is amazing, and very generous portion. Calzone great too. We’ve been quite a few times and are always impressed with the food and the service so I felt compelled to write a review
Amy W . 2022-04-08
MORE AT Google
Good honest local Italian restaurant
Habib . 2022-03-15
MORE AT Google
Superb Italian food, excellent wine list, great atmosphere and lovely service. I would highly recommend going. It’s a regular haunt for my friend and me.
ClaphamMan . 2022-03-04
MORE AT TripAdvisor
Love this place, amazing atmosphere and staff but could do with some vegan options…
Anna Elliott . 2022-03-01
MORE AT Google
Delicious dinner and fabulous service 😊
Arzan N . 2022-02-20
MORE AT Google
Very home-cooking style Italian - traditional but classy interior with very friendly service (particularly the tall younger waiter). Pricing is reasonable and the dishes are very solid/reliable, if not quite bursting with taste. Relatively busy regularly so always a good atmosphere in there - a great addition to Balham's restaurants albeit slightly away from the centre - would reccomend.
Richard Appleton . 2022-02-17
MORE AT Google
Fantastic food and great service by the team. They made an incredible effort for the birthday in our party and were always around when needed.
Jonathan Elliott . 2022-02-16
MORE AT Google
Fantastic restaurant with amazing staff! Complimenti
Pasquale Pappano . 2022-02-13
MORE AT Google
Amazing as usual! Food delicious and service amazing. Couldn’t recommend enough!
Tom Flack . 2022-02-09
MORE AT Google
The food was good. Nothing crazy, but very good quality. Cannoli were amazing though. The real high point is the service though. Everyone, but especially the head waitress (a very nice Italian girl) were extremely helpful, patient and accommodating. Even though we had a really messy baby with us :-) Definitely recommended! Dave
Dave G . 2022-01-30
MORE AT Google
Small, beautiful and intimate restaurant. Took my fiancé to celebrate her birthday and it was gorgeous. The staff sang happy birthday to her. It was special. Would definitely visit again.
John Jackson . 2022-01-11
MORE AT Google
10/10 food - perfect service and overall great experience. Unbelievable value, I could even say the best value meal I’ve had in London. Fully recommend !!
Annie F . 2021-12-28
MORE AT TripAdvisor
Such a nice restaurant food was lovely staff very friendly. I would definitely recommend this place.
Brenda Tomkins . 2021-12-21
MORE AT Google
Nice coffee and sandwiches! Will come again
Slavi Sensus . 2021-12-15
MORE AT Google
My friend and I had a cosy week night dinner here. We had the truffle pasta and Parma ham pizza with a glass of wine, followed by a hot chocolate. The food was delicious, perfectly sized portions and very reasonably priced. The staff were very friendly and attentive. Lovely ambience and felt very relaxed but still a great atmosphere! Would definitely recommend!!
pgod21 . 2021-12-15
MORE AT TripAdvisor
I had a lovely birthday celebration at Cuillosteria. Every course of food was absolutely delicious and even though it was busy the waiter service was attentive. I was given a surprise candle in my dessert and a round of applause and happy birthday in song! The people I was with thoroughly enjoyed the whole experience. Definitely worth going again.
Philly Sanders . 2021-12-14
MORE AT Google
Lovely Italian restaurant in Balham. Intimate and friendly , great service and of course great food.
david michelle sharp . 2021-12-10
MORE AT Google
Friendly with lovely food at a good price. Can't ask for more than that
Ken Cooke . 2021-12-05
MORE AT Google
Amazing Italian food, lovely place and they have a perfect pizza!
fabio amoroso . 2021-11-18
MORE AT Google
Bonne pizza et plat de poisson gourmand
Salvatore Santoro . 2021-11-15
MORE AT Google
Had a super relaxed Sunday lunch here. Great to not be in a chain restaurant and feel like service really matters to the people who work there. Great food, lovely wine and a good time had by all
worldcupwillie . 2021-11-01
MORE AT TripAdvisor
Had a really lovely experience here. The food was great and they catered well to vegetarian and gluten-free dietary requirements in the group. Staff were really friendly and helpful.
Islander2025 . 2021-10-28
MORE AT TripAdvisor
Beautiful people, beautiful food... Can't wait to go again!
Sarah Faherty . 2021-10-24
MORE AT Google
Authentic Italian - amazing wine and pasta. Lovely little quaint restaurant.
Pablo Talbot . 2021-10-06
MORE AT Google
Excellent family run Restaurant. The calves liver was delicous!!
George Sugden . 2021-09-26
MORE AT Google
Great food, good price but above all the
Paola Macchi . 2021-09-24
MORE AT Google
We’ve been to this restaurant many times and we always have a wonderful experience. The staff are warm, welcoming and the food is great. This is a wonderful restaurant for good Italian food, with a lovely relaxed atmosphere and friendly service.
GG_Rose98 . 2021-09-17
MORE AT TripAdvisor
Food = Excellent!! Service = Outstanding!! Really made us feel at home, staff were very attentive and would definitely recommend.
Mary A Hanum . 2021-09-13
MORE AT Google
Amazing food and service. The lobster with fresh spaghetti was the perfect dish in terms of flavour, value for money, portion. I would happily go back.
Adnan Hussain . 2021-09-02
MORE AT Google
A gem of a place in Balham. The food is of top quality. The staff and service was attentive but not over bearing. Will definitely go back to explore more dishes.
Dorothy Hickey . 2021-08-28
MORE AT Google
Very good and genuine Italian cuisine. Excellent fish, pasta and calves liver. Friendly and professional.
J R Anderberg . 2021-08-26
MORE AT Google
Great place great staff a big shout out for the great service from Chiara thanks for making it a lovely evening
davidnicholson115 . 2021-08-22
MORE AT TripAdvisor
5 stars out of 5 stars 10 August 2021 A wonderful Italian experience is great cocktails, authentic food and warm hospitality. Without a doubt my first trip to Ciullõsteria with my sister and nice ticked all those boxes
R7304EUians . 2021-08-11
MORE AT TripAdvisor
Good food, few mixed up dishes and had to wait a little for one for our groups as they didn't come out all at the same time. Service could have been better.
David Stanley-Tate . 2021-08-06
MORE AT Google
Disappointed with our food in this highly rated restaurant. The food did not seem fresh and some items seemed borderline raw. The staff were very friendly and welcoming but sadly this didn’t make up for the food we experienced on the evening. This was not...
theforce91 . 2021-07-28
MORE AT TripAdvisor
Food was excellent and at a good price. All the staff are very friendly. Had a lovely evening.
Dean W . 2021-07-20
MORE AT Google
We had a meal here on Friday evening. The food was excellent and the waiter steered us towards a very good rose wine for the same price as an inferior one that I was about to choose. I was very impressed with the food, wine...
schumi12 . 2021-07-05
MORE AT TripAdvisor
Very good little café in a handy Balham/Clapham location; the coffee was delicious and the prices very reasonable (especially for London).
Ricardo Wiggett . 2021-06-21
MORE AT Google
Fantastic Pizza and wonderful service!
lisa craft . 2021-06-03
MORE AT Google
We have lived just up the hill from this place for 3 years and only managed to go yesterday, we feel we have been missing out! The food was delicious, generous and authentic, service friendly and relaxed and a nice indoor space, will definitely become...
DrDavidRobert13488 . 2021-06-01
MORE AT TripAdvisor
Absolutely love this place! It’s proper authentic Italian food and it’s always amazing. The people are lovely and always welcoming as well. I will returning a lot more now everything is back open!
Sophie P . 2021-05-16
MORE AT TripAdvisor
The food is great and very affordable, service super attentive and the staff does go the extra mile to ensure you're having wonderful time. Me an my other half stumbled upon this place about a year and a half back and it's been out favourite dinner spot ever since. It's incredibly wonderful to see a place where owners are so invested and staff take so much pride in what they do. Could not recommended enough. ♥️
Katrina Nahtmane . 2021-05-16
MORE AT Google
Honestly one of the best restaurants my partner and I have visited in recent memory. Authentic Italian cuisine in a relaxed and clean environment. The food was full of flavour and Matt our waiter was an absolute gentleman.
Ravi Shah . 2021-05-15
MORE AT Google
Delicious food and excellent service.
catherine walton . 2021-05-08
MORE AT Google
Great restaurant with high quality pizzas. I would recommend it to anyone. One happy customer
Emma Dorothy . 2021-04-02
MORE AT Google
Amazing local, family run Italian restaurant. Food & service is always excellent, very much recommended. Lockdown takeaway also very good, especially the pizzas!
Ryan Woor . 2021-03-07
MORE AT Google
Perfect takeaway for a saturday night from this friendly, independent family restaurant. I chose Scialatelli alla marinara - the food was beautifully cooked, full of flavour and the pasta held it's temperature on the 10 minute walk home. A taste of southern Italy on the plate. Highly recommended.
La Franka . 2021-02-01
MORE AT Google
Lovely family-run restaurant serving amazing authentic food with a great little café next door. The portions were large with fresh ingredients, everyone at our table loved what they got. The owner and staff are very friendly too. Can't wait to go again when it opens.
S J . 2020-12-26
MORE AT Google
These schedules may not be completely accurate on special days. Please always confirm with the restaurant
Similary restaurants in London
117 Opinions
Not sure why this cafe gets such good reviews. It’s overpriced and there was a small selection of meals to choose from. Food is heated up in the microwave before serving. Would recommend giving it a m
cookedgarlicraviolimustpastafishchickenprawnsmeatcrabbeautiful643 Opinions
I go here with my kids whenever the wife travels for work. Despite the mess the children make, they always accept us with welcome and good humor, they prepare a good pasta quickly to satisfy the littl
cookedgarlicraviolimustpastafishchickenprawnsmeatcrabbeautiful113 Opinions
Amazing, authentic, great value food with friendly staff. We’ve visit as often as we can. So nice to come here for a casual meal and drink after work, or for a treat at the weekend.
cookedgarlicraviolimustpastafishchickenprawnsmeatcrabbeautiful