GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.4

Based on 1.767 opinions finded in 2 websites

site_photo4

Nº 122 in 440 in Lincoln

Nº 2 of 2 Thai in Lincoln

CUSTOMERS TALK ABOUT DISHES WITH..currybeautifulricemustcoconutsoupchickenduckcookedfishprawnschillispicyprawnfried

comment_iconOpinions

We ordered the SET 1 set meal for two & we thoroughly enjoyed it. Was blown away with the variety on offer and the taste 🌶️!! Will definitely be visiting again 🥘!!!

site_logo

Luke Smith . 2025-04-22

MORE AT Google

Excellent dining experience. Delicious food. Curtious and attentive staff. Would thoroughly recommend.

site_logo

Mark Grant . 2025-04-21

MORE AT Google

Really lovely service and food. I definitely recommend!

site_logo

linsey pollard . 2025-04-19

MORE AT Google

First time visiting this place and had a really enjoyable evening. We arrived without booking on a busy Saturday evening and they managed to squeeze us in. We chose a set meal for two and it was amazing! The Service was also great too and we will definitely be back for more!!

site_logo

Beautylass . 2025-04-16

MORE AT TripAdvisor

Una experiencia mixta. Si bien la mayor parte de la comida estaba bien, aunque carecía del sabor que normalmente esperamos en la comida tailandesa, algunos eran decepcionantes, por ejemplo, la sopa caliente y agria. El servicio era igualmente mixto: la camarera joven era servicial y sonriente, sin embargo, el resto del personal era mucho menos; tampoco parecía preocuparse por estropear nuestro disfrute haciendo un montón de ruido apilar platos en nuestra vecindad. Claramente un lugar popular, pero podría ser mucho mejor.

site_logo

PetandTig . 2025-04-08

MORE AT TripAdvisor

We had a lovely meal there last Sat with a group of 10. The banquet was delicious with a wide variety of tasty dishes

site_logo

Tony Matthews . 2025-04-07

MORE AT Google

Great gluten free options. Very nice authentic thai food. Great service and lively staff. Good value for money. Would not hesitate to recommend

site_logo

Martin K . 2025-04-04

MORE AT TripAdvisor

We both had Pad Thai and can honestly say it was the worst Pad Thai we had ever eaten, and we have eaten at numerous Thai restaurants, certainly won't be going back

site_logo

Darren Riley . 2025-03-28

MORE AT Google

Amigos nos invitaron a unirse a ellos para un almuerzo juntos - nunca habíamos visitado Tailandia número 1 anteriormente, pero sabían que disfrutamos de la comida asiática. Pedimos un banquete para nosotros cuatro, y el servicio y la comida eran exquisitos. Una selección tan maravillosa de platos y todos bellamente preparados y presentados. Bien vale la pena una visita para una ocasión especial!

site_logo

LoveAfricaLincoln . 2025-03-25

MORE AT TripAdvisor

Visité el viernes temprano por la noche y siempre ha sido uno de mis favoritos aunque no lo ha sido desde hace un par de años. Cuando llegamos, el hombre que nos saludó bien no nos saludó. Él nos llevó a una mesa y nos dijo que debemos irnos en una hora, que estaba absolutamente bien para nosotros, sin embargo, fue abrupto y un poco grosero con ella. Sin embargo, esa no es mi queja Ambos comimos pollo satay, lo cual estuvo bien, y luego tuve Penang Curry lo que mi amigo tenía curry verde con pad thai. Los sabores de mi curry estaban bien, pero no había absolutamente nada de calor en él. Apenas había fideos en el pad Thai, lo que era un poco extraño. No le dimos al restaurante la oportunidad de rectificar esto por nosotros, ya que nos habían dicho que necesitábamos salir en una hora y el personal estaba corriendo por ahí muy ocupado. Espero que esto sea único

site_logo

Rachel W . 2025-03-24

MORE AT TripAdvisor

Delicious food. We ordered Pad Thai with chicken and mango juice. Service was very nice. We waited a short time for the meal.

site_logo

Milena Zych . 2025-03-09

MORE AT Google

Visitado en varias ocasiones. El servicio y la comida siempre es de buena calidad. El mejor tailandés que hemos encontrado en la zona. Recomendaría

site_logo

Stewart F . 2025-02-06

MORE AT TripAdvisor

We loved the food so much, we ate here two nights in a row. Service was friendly and really fast.

site_logo

Belinda Forbes . 2025-02-05

MORE AT Google

Beautiful Thai food. Amazing staff. Atmosphere is buzzing. They’re busy and loved, and they absolutely deserve it! Thank you for a wonderful time 🫶.

site_logo

Aliwan Sway . 2025-02-04

MORE AT Google

Food was amazing, chicken pad thai was delicious, very nice staff

site_logo

Damon H96 . 2025-01-30

MORE AT Google

Fuimos atendidos eficientemente y rápidamente por el personal más atento y educado. La comida era muy sabrosa. La mejor comida tailandesa que hemos comido durante mucho tiempo. Sabores y variedad fueron excepcionales

site_logo

Karin B . 2025-01-29

MORE AT TripAdvisor

Sorry but i’m so unbelievably dissapointed that i wasted my money on this. the food was decent but not worth £40 for one person. i wouldn’t even pay £20 for that. I don’t understand how a £20 curry dosent come with rice…. all curry should be served with rice. called up a couple of times and service was pretty unacomidating. I could make better at home, really wasn’t worth it at all. wont be ordering from them again.

site_logo

Ashira Sears . 2025-01-25

MORE AT Google

First visit on Saturday Evening, after hearing many good things. I would describe the building and service as perhaps a bit too stereotypical of what we as British, expect of Asian style restaurants - a little dated in terms of decor and the service is pleasant but abrupt. However, the menu and the food are fantastic, and you come to realise that maybe we are too busy judging appearance and mentality these days - we go somewhere because the food is good - and Thailand No1 is absolutely spot on for flavour, originality, texture, portion size and presentation. Looking around the room we were in, you could clearly see wonderful dishes of food on every table, and we shall certainly return

site_logo

Ben Mcloughlin . 2025-01-19

MORE AT Google

Servicio de calidad superior y buenas salsas / sabores para acompañar alimentos base variados. Galletas de gambas que saben a gambas! Menú flexible y buenos consejos a la hora de pedir. Buenos vinos también, inusual para un tailandés.

site_logo

Graham P . 2025-01-13

MORE AT TripAdvisor

Este ha sido un lugar favorito para nosotros alrededor de 15 años y nada ha cambiado en ese tiempo la comida solo ha sido perfecta ya sabes exactamente lo que estás recibiendo, fabuloso como siempre muchas gracias.

site_logo

charlie . 2024-12-30

MORE AT TripAdvisor

Incredible. One of the best Thai restaurants in the country

site_logo

Ben Purton (Ben Purton Enablement) . 2024-12-22

MORE AT Google

Really tasty food, friendly staff, prompt service

site_logo

Caroline Howes . 2024-12-15

MORE AT Google

Comida muy sabrosa, no estaban esperando mucho a pesar de estar ocupado. Personal amable y buen ambiente. Recomendaría a cualquiera visitar

site_logo

Caroline H . 2024-12-14

MORE AT TripAdvisor

Had a great dinner. Food was excellent even though it was incredibly busy. Just wish Prosecco was available by the glass instead of by the bottle.

site_logo

Debra Hilton-Wright . 2024-12-09

MORE AT Google

Had a takeaway from the restaurant £48 for a shared starter and one main dish. It was TINY. £25 for the starter for 2!!! Never again. It was cold by the time it arrived to us too.

site_logo

Mary Twomey . 2024-12-06

MORE AT Google

Would need to go again, but my first visit (and a sneeky peek at the food of others as I walked by) is enough to be able to say this is one of the best Thai restaurants that I've been to. It was Lincoln's 'Turn the lights on night' Friday 29th November. It was freezing, so we opted for somewhere close to our accommodation (Cathedral View Guest House - run by Paul and Christina, and a fabulous place to stay and subject of a separate review). We both like Asian flavours, me in particular, so this seemed the perfect place. It was busy! However, the phone call 45 minutes previously had secued us a table for two right in the window, and Far from the Madding Crowd (I live in Dorset). We wee immediately served our drinks of choice and started to pore over the menu. For me, there are two good tests of any Thai restaurant; Laab Kai, and Pad Thai. Which to have? Well, it was cold outside so I took the Laab, adding that it should be prepared fiery hot - my preference. Definitely all was as it should have been. I even asked if it could be served in iceberg lettuce leaves (they make nice cool wraps to balance out the fiery contents) and was provided almost a whole lettuce. Just fabulous - didn't even have to ask for extra creen chillies. My beautiful wife (as usual, immediately the focal point for the males in the restaurant - honestly, I'm so lucky), ordered a sweet and sour chicken - in fairness, one of her comfort foods. I'm glad to report that this was a super-uplevel on sweet and sours past. Drenched in delicious sauce, yet retaining that crispiness so sadly absent in ordinary versions, the chicken inside was like velvet; truly delicious. I polished the rest off after she'd finished....which I'm almost ashamed to admit, is not an uncommon event when we dine. We don't go to Lincoln enough and I've decided we need to install some imaginary friends there that we go and visit on a regular basis; the cathedral is magnificent, Cathedral View offers fantastic lodgings in a historic building, and now we have a place to eat that I suspect I will not easily tire of.

site_logo

Martin Chapple . 2024-12-03

MORE AT Google

One on the best Thai restaurants we have eaten in the Uk. The satay chicken starter was delicious. The service was excellent and the restaurant was full by 7pm so you must book before going . A must if you love Thai food

site_logo

Vanessa Lavery . 2024-11-27

MORE AT Google

Very good food , reasonable prices , stuff amazing , We've been first time - and will definitely back again.

site_logo

Eleonora Daskala . 2024-11-24

MORE AT Google

Segunda vez que visitamos este restaurante Es magnífico. Excelente opción de menú, servicio, personal atento. Recomendaría encarecidamente

site_logo

cookiesmum2019 . 2024-11-16

MORE AT TripAdvisor

Absolutely beautiful food, best Thai I've had in ages. Pad Thai Chicken and Sweet & Sour Chicken were both epic.

site_logo

Alana Benson . 2024-10-31

MORE AT Google

Vaya, qué gran hallazgo. Logró reservar durante una estancia reciente en Lincoln. Recomendado este restaurante por nuestro personal de recepción del hotel. Buen trabajo que reservamos ya que el lugar estaba lleno. El personal era muy acogedor y amable. Mucha elección en el menú, teníamos el Massaman Curry y Pad Prik Khing con arroz y un poco de verduras. Toda la comida era increíblemente sabrosa y el tamaño de la porción era bueno. El servicio fue rápido y también tuvimos una botella de vino tinto. El personal era atento y educado. No puedo calificar este restaurante lo suficientemente alto. Magnífico. Y el valor era increíble también. ¡¡Dos tuberías, dos arroces y una botella de vino por menos de 60 libras! Vaya.

site_logo

stevegoulden7 . 2024-10-30

MORE AT TripAdvisor

Excellent service and food even for our large work group and not the first time! I'm not Thai and never been to Thailand to know how authentic the food is but it's delicious and i won't question it. Also seeing a fair number of Asian customers is a good indicator. Always enjoy visiting and eating here and i will be back, thank you.

site_logo

Tyler Watts . 2024-10-29

MORE AT Google

Very delicious dishes with a variety of protein options. Also cheap for drinks!

site_logo

Lydia Winter . 2024-10-29

MORE AT Google

Visited this lovely restaurant in lincoln and Wow lovely staff and the food was amazing I recommend this restaurant to anyone who likes traditional Tahi food

site_logo

Andy Dunkley . 2024-10-27

MORE AT Google

Muy buena comida y personal servicial. Fue anoche, así que estaban moderadamente ocupados, pero no esperé mucho. Los precios son razonables.

site_logo

Katie G . 2024-10-15

MORE AT TripAdvisor

An interesting place recommended by passers-by. It would be useful to include some photos of meals on the menu. For an average foreigner who is not an expert in Asian cuisine, buying a meal is a shot in the dark... which does not change the fact that the food is tasty... spiced and, it must be said, worth recommending.

site_logo

Adams . 2024-10-12

MORE AT Google

Excelente cena. Gran pequeño hallazgo. El personal atento y la comida deliciosa. Gran relación calidad-precio también. Sin duda comería allí de nuevo

site_logo

Relax46862838446 . 2024-10-02

MORE AT TripAdvisor

Food is always spot on, it can't be faulted. Staff are very polite and professional. The only drown side is that a surcharge is applied to the bill which can add a significant increase, so be aware.

site_logo

Michelle Counte . 2024-10-02

MORE AT Google

Busy, lovely food, need to book

site_logo

Tracy Ball . 2024-09-20

MORE AT Google

The food was excellent, as always. If anything it was better, as the menu seems a bit more varied and the portions of rice have been increased to a perfect size further curries. The service however is awful 😖 We were rushed in, were asked if we had drinks 7 times before the drinks came, which were relatively quick to arrive. Our starter orders were taken before the drinks arrived. We asked for more time, but were ignored, we ended up ordering some starters to share and asked for a bit of time for the main meals. We had the starters quickly and felt we were being rushed to clear the table :( The starter plates were cleared before we finished. So my mum was still eating her satay, and the waiter was clearing the other plates at the end of the table waiting for her to finish. Then we had hot plates and the candle warmers for the curry placed on the table, then we waited for over 30mins, more like 40mins for our mains :( It was hot, it was noisy, all the waiters but one do not know how to smile, plates are dispatched very abruptly, there is no attempt to make you feel welcome, but the emphasis is on getting you through the chain as quickly as possible. Not good at all, and although I have in the past said I will not go back, I did go back last night. I will not go back this time, definitely.

site_logo

Meriem Bertouche . 2024-09-16

MORE AT Google

Good quality food. Served quickly. Nice staff. Please note service charge is automatically added to bill. Recommended.

site_logo

steve edwards . 2024-09-16

MORE AT Google

A lovely friendly and very efficient staff serving excellent quality reasonable priced food

site_logo

Peter Bowes . 2024-09-15

MORE AT Google

We enjoyed one of the preset menus. The food was delicious, very filling, and presented beautifully. Staff were attentive and friendly. We will definitely be going back again.

site_logo

Rebecca Parvin . 2024-09-14

MORE AT Google

The red curry tasted amazing, great balance of creamy and spicy and was a generous portion. Also tried some of my wife's Pad Thai and that was also great tasting. Service was really good, quick without feeling any pressure. Would definitely come again and recommend to friends.

site_logo

Garry Johnson . 2024-09-01

MORE AT Google

Excellent red duck curry and sharing starter. Seating felt a bit squashed in where we were sat when the conservatory was empty. Did feel rushed. Plates taken when still eating the nibbles prior to starter and when eating main course asked if I'd finished, I replied no. It was my daughter's birthday meal so would have liked time to relax bit you can only have the table for a certain length of time

site_logo

Marie L . 2024-08-30

MORE AT TripAdvisor

I like atmosphere there! Thank you for all hard working staff!

site_logo

JURIJUS Ivanovas . 2024-08-24

MORE AT Google

Simply the best Thai meal I've had. We shared the set meal A for two. It was hot, tasty and there was plenty.

site_logo

Steve Butler . 2024-08-18

MORE AT Google

Had a fantastic meal Excellent food and great service

site_logo

tim o'l . 2024-08-17

MORE AT Google

Friendly and helpful staff. I need a gluten free diet and the chef adapted the menu to accommodate this with no fuss. The food was amazing and excellent value with more than we could eat. The venue stretches back and is much bigger than it looks from outside . Situated in the cathedral tourist area so easy to find, also open on a Monday when a lot of other restaurants are closed.

site_logo

Jenn Steve B . 2024-08-13

MORE AT TripAdvisor

We tried three dishes and all three were very tasty. Thai food is spicy, but it was delicately spicy. The shrimp and vegetables are perfectly cooked. I recommend visiting this establishment.

site_logo

Ruslan Vasilyevich . 2024-08-10

MORE AT Google

A nice evening: the food, ambience, location and service were all fine. We were slightly mystified by two things though. We ordered one Chef's Platter £9.95, thought it looked good value when it came, then found afterwards we'd been charged £19.90 for it, so presumably a double portion... There was also a mysterious £3.55 "Seafood" charge that we didn't understand.

site_logo

RoamingJeff . 2024-08-07

MORE AT TripAdvisor

After reading reviews of the other Thai restaurants in Lincoln, we opted for this and were not disappointed. Great traditional decor, a friendly welcome and fantastic service throughout. Food was excellent 🙏🏼 Definitely recommend.

site_logo

Robert PJ . 2024-08-04

MORE AT Google

First of all the service was great and staff extremely helpful. However, I cannot be so positive about the food - it was tasty but not the fresh strong flavours I have known in other Thai restaurants. I found the sauces for the main dishes, quite watery, although the share starters were delicious. We were never rushed and the atmosphere was busy and lively.

site_logo

Sippingpimms . 2024-08-03

MORE AT TripAdvisor

Lovely Thai food with great staff.

site_logo

Alastair Woolley . 2024-08-01

MORE AT Google

Absolutely amazing it's our second time eating here and we love the place, the staff are warm and very welcoming. The food is great you get plenty and not pricey at all. If I was local to the area I would eat here more ! If you love Thai food or wanting to try it and you're near here then give them a visit.

site_logo

Vic “Webley37” Williamson . 2024-07-16

MORE AT Google

Very good food and service. Would thoroughly recommend.

site_logo

Doug Bell . 2024-07-12

MORE AT Google

Absolutely delicious food and kind service.

site_logo

Alina Asad . 2024-07-09

MORE AT Google

Comforting and consistently delightful. We’ve ordered takeout on several different occasions and it has never disappointed. Hot, fresh, and with great portion sizes, this is our go-to for great Thai food!

site_logo

Breanna Duffy . 2024-07-04

MORE AT Google

I have dined here now 4-5 times, every time the service has been fast and the food has been great. I recommend the set meal. Also book a table in advance on weekends, it's always busy. The best Thai food in Lincoln.

site_logo

MurPhinzo Murphy . 2024-07-01

MORE AT Google

We had a lovely experience eating here. The staff are professional and obliging, the soup was very tasty and the red and green curries we ordered had the right amount of spice heat and good flavours. The house red wine was quaffable and I’d definitely eat there again.

site_logo

moonbag1 . 2024-06-29

MORE AT TripAdvisor

Excellent meal good service priced well 🙂😁

site_logo

Michael Hanlon . 2024-06-20

MORE AT Google

If you like Thai food, go here, it's amazing, go pick it up, it will be warmer

site_logo

Vlad “Vladius” S . 2024-06-15

MORE AT Google

Very welcoming, extremely polite and efficient service. We had a banquet for two people which was superb, varied and tweaked for a specific dietary requirement. Nothing too much trouble. The freshness and authentic flavours absolutely shone through. Price very reasonable for such quality food. Only regret was not being able to finish the mains after a delicious soup and a mixed platter of starters.

site_logo

GoodOleTaid . 2024-06-09

MORE AT TripAdvisor

No problems with the staff or service. Very professional and polite. I was just very disappointed with the taste of the food. I found the chicken of set B to be very dry and the starters to taste quite plain.

site_logo

Oriachim . 2024-06-07

MORE AT Google

Used to come here regular. Not been for a few years but it must be a different chef because the red curry I always have was gloopy, which it never used to be. Tasted like it was out of a packet rather than cooked fresh. Price has almost doubled as well. Won't be back I'm afraid.

site_logo

xpyda man . 2024-06-03

MORE AT Google

Food was amazing quick friendly service

site_logo

Colin P . 2024-05-28

MORE AT Google

First time trying this Thai restaurant, very impressed with the food very tasty, friendly welcome too. Will definitely be back again soon.

site_logo

Andy Savage . 2024-05-27

MORE AT Google

Quick service, good value, one of the best Thai Green curries I've had, and the pad Thai was very good too. Overall, we would highly recommend.

site_logo

Josh Gilmour . 2024-05-25

MORE AT Google

Perfect, best Thai food in lincoln

site_logo

Alice Thorpe . 2024-05-24

MORE AT Google

Really nice food, bit cheeky adding a service charge without asking..

site_logo

lee Hudson . 2024-05-24

MORE AT Google

Wow the older lady serving(maybe owner or owners wife) needs an attitude transplant. You would think she was paying you to eat there. Do not bring a child in a pram or buggy didn’t seem welcome not very accommodating to children. Food excellent.

site_logo

Craig Brown . 2024-05-22

MORE AT Google

Delicious food and very attentive staff!

site_logo

Laura M . 2024-04-29

MORE AT Google

We had lunch here. Excellent Penang curry which was served quickly and efficiently. Very nice staff and pleasant atmosphere. We aren't local (🥲) but would definitely visit again if in the area!

site_logo

Linda Bowen . 2024-04-25

MORE AT Google

Have eaten here quite a few times now with friends and family. Yet to be disappointed and I'm looking forward to my next visit. Highly recommended

site_logo

Franco Iannelli . 2024-04-24

MORE AT Google

Popped in for lunch, food was great and the service was excellent

site_logo

Dove Hunts . 2024-04-16

MORE AT Google

Very close to the lincoln cathedral... Loved the Thai Green Curry & fried rice... Good vegetarian and gluten free options... The staff are very friendly, accommodate requests & serve with a smile... Certainly worth a try - please call & book seats in advance , as it looked very busy while we dined...

site_logo

Explorer . 2024-04-09

MORE AT Google

Great food as always, quite expensive but good quality. I do understand that food is expensive these days but I do object to a Service charge being added automatically. Otherwise it is a nice meal.

site_logo

stevieuk . 2024-04-06

MORE AT Google

Nice Thai restaurant with all the usual menu options. Well prepared food and good service. Reasonably priced too.

site_logo

Jason Inglis . 2024-03-24

MORE AT Google

Authentic in the sense that it is made by Thai chefs and it has a broad, interesting menu. The food is definitely adapted to western tastes, though without the balance of flavours food in Thailand has. Tofu Laab was VERY sour (I like sour so it was fine) and the mushrooms were insanely sweet - both bordered on tasting like British Chinese food at times for me. Pork Pad Kra Pao had a slight boar taint flavour and the mushroom tomyum was a bit… sad. It’s very busy (we went Friday dinner time) so I’d recommend booking in advance. Jasmine, our server, was very attentive, polite and great to chat with.

site_logo

Jay R . 2024-03-23

MORE AT Google

The food here was beautiful, small portions so a little overpriced my partner and I ordered a sharing platter and a main thinking we'd not be able to manage anything else, we don't eat a lot as we fast and eat once a day, well we left and had to pick up food from the shops to cook at home as we were both starving. The sharing platter is almost £20 and although lovely was disappointing. The Pad Thai was delicious, My partner ordered Duck in Tamarind and the waiter bought him prawns, we pointed out the mistake and they took his plate away leaving mine on the table to go cold for 10 minutes before taking mine away to reheat until they bought the correct meal out for my partner. I think if we wanted Thai food again we'd consider ordering a takeaway from here but we won't be eating in, the service from the wait staff wasn't very friendly seemed rushed, we asked for water and our glasses were slammed on the table, our waiter never spoke once to us other than to take our order (that he took wrong) not a great atmosphere. Would possibly benefit from some new servers.

site_logo

Sophie Robinson . 2024-03-22

MORE AT Google

The food was delicious. Service was on point. The flavours were just amazing. I don’t like two green curry as a rule but this one was very tasty without to much heat.

site_logo

stuart haines . 2024-03-16

MORE AT Google

Ordered take away for collection at specified time. Received email confirming order and another email confirming order in progress. Arrived at said time to collect and order had clearly not been processed nor cooked. That said meal was great & very tasty, just disappointed that if you turn up at collection time it’s not cooked. Deliveroo would have been quicker!

site_logo

helsb31 . 2024-03-09

MORE AT TripAdvisor

Very good Thai food, very quick service & delicious food. Lots of choice on the menu. We went on a Sunday night & it was surprisingly busy. Very reasonable prices.

site_logo

267sally . 2024-03-07

MORE AT TripAdvisor

The food was nice but the service was disgusting they stood over us and kept telling us to hurry up as they had another sitting. They were so rude the whole night that it ruined my birthday meal.

site_logo

Rachel Munn . 2024-02-25

MORE AT Google

I had an evening meal here, really nice food no idea what I had, a stir fry type chicken dish with noodles and rice etc. welcoming and friendly staff, good service and the prices were fine.

site_logo

Kegman 81 . 2024-02-24

MORE AT Google

The food was nice but the service was terrible. They stood over you and kept asking us to hurry up. It was an expensive and an awful experience. I will not be going back, what a horrible birthday meal out.

site_logo

Rachel M . 2024-02-24

MORE AT TripAdvisor

Deserved No1 Status! Restaurant was busy for a Wednesday night but the staff were friendly and efficient. Drinks and food were served quickly and was extremely delicious. Very happy to return, at least you can walk the calories off getting up the hill!

site_logo

DT M . 2024-02-22

MORE AT TripAdvisor

Absolutely amazing food. I will visit Lincoln again just for dinner! Seriously good food.

site_logo

Lynne Smith . 2024-02-22

MORE AT Google

Great service. Lovely ambiance but above all the most delicious Thai food we have had in ages. Worth a trip to Lincoln just for this meal. Our only regret is we found it on our second day here.

site_logo

614lynnes . 2024-02-22

MORE AT TripAdvisor

Fantastic food, highly recommend!

site_logo

Kev Mycock . 2024-02-21

MORE AT Google

Superb food and efficient, accurate service. Didn't have a booking and they were full to the gills but we were able to take our seats after a short wait. Considering they were so busy, service was prompt, helpful and friendly without any fuss. Food was simply excellent, best green curry I've had. If you're going on Friday or Saturday night best to book in advance or a larger group might have to wait a while. Highly recommended.

site_logo

P M . 2024-02-19

MORE AT Google

In Lincoln with colleagues and saw this restaurant. Friendly service which was very good but the food was outstanding! If they say a dish is spicy then it is spicy! I'm back to Lincoln again in a few weeks and I can't wait to return to this restaurant!

site_logo

Ian F . 2024-02-18

MORE AT TripAdvisor

What a great restaurant, we hadn't booked but a table for two was found. We had a set meal for two which was good and more than we could eat. The service was quick and friendly. Will I go back again? You bet!

site_logo

mickchicken . 2024-02-16

MORE AT TripAdvisor

Went for lunch today wonderful food with very good service definitely visit again

site_logo

Sandra Holmes . 2024-02-13

MORE AT Google

Food was flavourful and fresh. The restaurant is popular so there is a good vibe of good food being enjoyed and the location at the top of Lincoln is surrounded by great shops and pubs.

site_logo

Ian Thomas . 2024-02-05

MORE AT Google

Different take on Thai food .. will go again.

site_logo

Jeff Hughes . 2024-02-01

MORE AT Google

Food was delicious, presentation exceptional and service very good/friendly. I do think the tables are a bit close together - not ideal.

site_logo

Fiona . 2024-01-27

MORE AT Google

Fabulous food with authentic taste, just like being back in Thailand. The hot and sour soup was delicious and kind of the waitress to point out the chillies were very hot. The whole of the banquet b was great, sauces with the king prawns and yellow curry were excellent.

site_logo

mcleodalimc . 2024-01-22

MORE AT TripAdvisor

Great place good value for money.

site_logo

Ray OConnor . 2024-01-20

MORE AT Google

This restaurant is well worth a visit. The staff are very friendly and inviting and the food is good. We had set meal B which we enjoyed. It does get very busy so I would book before hand

site_logo

Jojoski31 . 2024-01-12

MORE AT TripAdvisor

Similary restaurants in East Midlands

restaurant_img
4.5

203 Opinions

location-icon11 Corporation Street
Thai
outdoor_seating_155113takeaway_155113delivery_155113

If I could give 6 stars I would. Had a lunchbox yesterday & was really nice. Today had jungle curry & chips ~ I could eat this everyday. Lots of meat. Staff are so friendly & polite. I’ll miss this shop when I go back home to Nottingham