GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.0

Based on 184 opinions finded in 1 websites

site_photo3

Nº 258 in 474 in Arun

Nº 3 of 4 Thai in Arun

CUSTOMERS TALK ABOUT DISHES WITH..curryfishchickenspicyprawnricefriedladycooked
Score
OpinionsNoteTripAdvisor1844.0

comment_iconOpinions

Portions reasonable - always tasty - good value for money - good service - nice location ( Shame ADC built the berlin wall outside so no river views anymore)

site_logo

Andy W . 2022-06-12

MORE AT TripAdvisor

Delicious food, reasonably priced. Charming waitresses. Nice surroundings and decor, very romantic actually. Nice view of the river. Fast service, who could ask for more!

site_logo

Gogo Y . 2021-09-26

MORE AT TripAdvisor

OK, so to start with, apart from the owner the ladies where absolutely fantastic. The food was very nice. But.. We waited for a starter 40 minutes, I asked how long for the main, because the restaurant was not busy at all. Waiter said that they would only start making it, once the starter is finished , I asked for the food to be packed to take away, as we just waited too long, and we have no time to wait longer. When I mentioned that we nearly waited for starter for an hour, the owner ran towards us with a check, ranting at us, that it's 40 minutes, not an hour! Than the excuses followed, we are short of staff, we are late, we are behind, all the restaurants are...so basically just shut up, and don't complain. You know, I was shocked, I worked in the customer service all my life and I was shocked. I explained that through 15 years of coming here, we never had a problem here. I could hear quite loudly him and the waiters laughing and talking at the back that he worked here 18 years. No one was even close to apologise, it was our own fault, that they are short of staff! It was very stressful, and quite disappointing evening, definitely not coming back, the food is amazing though.. But the service... Made us feel so bad, that we even said anything!

site_logo

Laura K . 2021-09-11

MORE AT TripAdvisor

Our first visit since the restaurant has been under new ownership. Nice to see that the tables now have tablecloths and not wipe clean Formica! Very friendly staff, the young lady who served us was most attentive and efficient. We were impressed by not only the quality of the food but also the presentation. We all had different dishes and they were all fresh, hot and authentic. Definitely want to return and try some more. Highly recommend.

site_logo

Anne D . 2021-08-27

MORE AT TripAdvisor

We visited the restaurant on Thursday evening, it wasn’t particularly busy and there was a man and a young girl serving. Both were helpful and welcoming and we had a lovely chat with them both. The food was beautiful, tasty, hot and superb, we could fault it at all and there wasn’t a scrap left on our plates! What a real gem of a place to visit, we will certainly be back

site_logo

Wilson168 . 2021-06-19

MORE AT TripAdvisor

Great friendly service and the food was amazing. King prawn pad Thai very authentic and the Thai green curry fresh and fragrant. I would definitely recommend

site_logo

bennety2020 . 2020-10-25

MORE AT TripAdvisor

Waited an hour and 20 even though the place was empty for the worst Tai food we have had. Some of the food was so terrible my hungry daughter couldnt even eat it. The rest was very bland. We phoned to politely complain and they were all over the place, and wouldnt accept it. Afterwards the boss even had the cheek to call us back and rant at us! Unbelievable and disgusting customer service. Bad food and terrible attitude. I doubt they will last long if this is how they treat people.

site_logo

Jez S . 2020-10-18

MORE AT TripAdvisor

We live locally and have eaten in the Thai kitchen a few times an also had takeaways before. It has always been a slightly “hit or miss” experience... but on the whole the food has been good if a little pricey. Tonight we ordered online and waited 2Hrs40 mins for our food (20mins over the advised delayed time) when it arrived items were missing, we rang and this was rectified quickly. My annoyance isn’t about the delay or even the missing items, it’s that the food was poor. The beef salad was mainly chunks of onion & tomato with boiled tough beef, the chicken satay had a weird hard sinuous texture, the chilli chicken was boiled chicken in a watery sauce with raw veg. The green curry was better as were the dim sum. This wasn’t a cheap takeaway and in tough times like these it’s considered a luxury in this house, I think it will be a long time before we spend our money here again.,

site_logo

864lucya . 2020-10-03

MORE AT TripAdvisor

Ordered online and booked a delivery slot. Arrived an hour late. We’d ordered seafood tempura and a seafood red curry. Described online as having cod, squid and prawn. Absolutely no cod to be seen in any of our dishes. Overpriced for what we received and will not be troubling Thai Kitchen again.

site_logo

Rust400 . 2020-06-13

MORE AT TripAdvisor

Absolutely delicious fresh food always ordered from here the customer service could improve but the food is 10* would recommend anyone to order food as a takeaway

site_logo

Brandon2848492 . 2020-05-22

MORE AT TripAdvisor

The worst customer service I have received in a very long time and terrible food, The fish we ordered was significantly overcooked and had no sauce to speak of. I cannot recommend you avoid this establishment more highly than following the treatment I had today.

site_logo

Michael M . 2020-04-25

MORE AT TripAdvisor

We enjoyed a delicious takeaway. Food arrived hot. Good sized portions. Delicious penang curry. It was a saturday night and the restaurant must have been busy as delivery time was put back 45mins after original order but this was communicated quickly through kukd, so no problem.

site_logo

Fionajane23 . 2020-04-21

MORE AT TripAdvisor

lunch last Fri, food was beautifully cooked, freshly cooked to order. light, not greasy, but lovely authentic flavours. I had banana fritters for dessert. Oooh!!! these were the best i've ever had. And I love banana fritters! pieces of banana individually cooked in light crispy batter, with sesame seeds on top and light maple syrup. some places i've been, theyre heavy, greasy. these were heaven in a dish!! finished off with pot of jasmine tea. service Excellent. my friend and I had a lovely lunch and really enjoyed it.

site_logo

BakingFan . 2020-02-24

MORE AT TripAdvisor

I have had two take aways and both have been beautiful just as good as eating in. Excellent food,excellent delivery time

site_logo

melanieh360 . 2020-01-01

MORE AT TripAdvisor

Bought a meal via their chosen web portal called Kukd. We were originally told the delivery would take 45 mins which was ok. Then we received another email to say our order would take another 90 minutes!! That’s a total of 2hrs and 15 minutes! The Kukd website says you must phone the restaurant to cancel the order. However when you phone the restaurant they say you have to phone Kukd to cancel and get a refund. Will never use either again.

site_logo

688chrisg . 2019-11-29

MORE AT TripAdvisor

Ate here October 2019, three of us.We chose the set meal for 2 (£50) as it was more than enough when we last ate here.No difference this time. Masses of food and even with 3 of us we couldn’t finish it.Food was excellent too. No problems with that.What went wrong was the service. It was so, so slow. And the place wasn’t busy either. Apparently they had some problem with the chef, and the owner was very apologetic.It didn’t ruin the meal but it did mean it wasn’t the great experience it might have been...

site_logo

I5525YDpeterb . 2019-10-27

MORE AT TripAdvisor

We visited Littlehampton just after the busy holiday season & were looking for somewhere to eat. It seems most places either closed early or opened only latter part of the week. Being a Tuesday night & it was already about 9 we were almost giving up on finding somewhere. Saw this place was open & decided to give a try. We did not regret it. Food was lovely, cooked by the owners Thai wife so delicious authentic food. Owner was friendly & chatted with us & the experience overall was lovely. We didn’t feel rushed even though it was late & we were the last customers in there. Would return again if we were in the area.

site_logo

gitar2014 . 2019-09-10

MORE AT TripAdvisor

There wasn't anything bad...but there wasn't anything to make me return either. The staff were lovely and the food most definitely edible but it was very average. We were the only customers. 🙁

site_logo

BrionyA_13 . 2019-09-01

MORE AT TripAdvisor

Food was excellent. Fresh and good quality ingredients being used. Cooked by the owner's wife from Thailand, so as authentic as it gets. Very friendly staff. Excellent value.

site_logo

Matthew W . 2019-08-19

MORE AT TripAdvisor

Sorry guys, I Love this place, either as takeaway or restaurant, but for the second time in a row this place has proven to be poorly managed. 45 min between the starters and the mains.... and when asked, the manager tried to tell me I am wrong.... that it is normal when it is fresh food to wait 45 min between dishes... I am sorry but I regularly sequence star Michelin tables and this never happened to me before. Just apologise do not try to argue. And the table next to us did not receive exactly what they ordered (shortage of shrimps), without telling them when served. Exactly what happened too us last time we went to this place. It is so much a shame as the cook is so great. I hope the lack if proper management will not kill this restaurant. Sorry to be rude, but I had to tell it.

site_logo

ericlemartret . 2019-07-28

MORE AT TripAdvisor

Ate here on a cold, windy night in June. The place was empty.

site_logo

I5525YDpeterb . 2019-06-14

MORE AT TripAdvisor

Went out with my thai friends and pre order food out from menu chef was happy to do that for us as we like real thai food ,good food all fresh and yes very yummy .good price .

site_logo

HeathD70 . 2019-06-10

MORE AT TripAdvisor

Normally I dont like to write poor reviews; however I was disappointed at my visit here.

site_logo

CampbellTraveller . 2019-06-09

MORE AT TripAdvisor

Thai Kitchen is my takeaway of choice locally. The food is almost always first class (only once have we been slightly disappointed). We like to eat in occasionally, but it's often very quiet when we go and so there's not a lot of atmosphere. I went with three friends on Saturday night (one of them has already left a brief review) and the restaurant was reasonably busy. We received our drinks and starters OK, but then had to wait over an hour for our mains, by which time we were nearly 'past it' as far as appetite goes. We were actually debating whether to just leave and go to the curry house next door when the food eventually arrived. The food was excellent, but it is not acceptable for customers to have to wait so long for their food. Please improve this or risk losing customers.

site_logo

delicious_manager . 2019-05-20

MORE AT TripAdvisor

Arrived with 3 friends, ordered starters and have waited one hour for main, asking for the main told another 30 minutes more. Not sire whether to rate the food or starve

site_logo

P2002BIjonathanp . 2019-05-18

MORE AT TripAdvisor

We went in for lunch as its been on our places to visit. We where disappointed the service is very slow. Overall the meal was okay but I felt the sweet and sour was all a bit sweet and lacked in sour. We will stick to our normal Thai in the future

site_logo

314clivem . 2019-03-31

MORE AT TripAdvisor

Always tasty food with good quality ingredients! If you love seafood you will love the seafood curry or a prawn dish!

site_logo

RebeccaN1905 . 2019-01-29

MORE AT TripAdvisor

The owner's wife, who is Thai, does the cooking. As a result it's tasty, spicy and authentic. Kung Fu Panda would love her noodles! And all for £7 for the average main course. It's a favorite stop for us after walks along the riverside or the seafront.

site_logo

lynnejames58 . 2019-01-16

MORE AT TripAdvisor

I live in London and love fresh Thai food. I visited this restaurant with my auntie and I have to say that it it is the best Thai food that I have had, outside of London.

site_logo

Sarah C . 2019-01-12

MORE AT TripAdvisor

Good choice, great flavours. Not overly generous portions and more expensive than I would have expected but the standout Thai restaurant in the area.

site_logo

TanyaS63 . 2018-12-14

MORE AT TripAdvisor

Just had a lovely meal at Thai Kitchen. Decided to go to this restaurant for a business lunch. I found the service to be exceptional and a perfect atmosphere for the circumstances. Best food in the area

site_logo

Angels C . 2018-12-02

MORE AT TripAdvisor

Been here before and had great food but if I could give this place minus stars after last night I would. 45 minutes to wait for a lukewarm starter and after being told it may take a while for the food to come out we decided to leave. Other tables in the restaurant had also been waiting hours for a main course. Completely unprofessional and it is clear that the owner does not care for the restaurant customers and apparently is only interested in takeaways. Arguments were heard in the kitchen just to finish off the experience. The young waitress was apologetic and we did feel sorry for her having to rely on poor kitchen service. Best to avoid!

site_logo

James S . 2018-11-25

MORE AT TripAdvisor

Far too slow on service! 45 minutes before starters were served and that was after15 mins after drinks order arrived! Not sure we will go again.

site_logo

digby12015 . 2018-10-26

MORE AT TripAdvisor

We decided to go out for dinner .. last minute thing and fancied Thai so we went to Thai Kitchen in Littlehampton. Experienced less than average service and overheard discussion between the owner and his waitress for the entirety of our meal ... so unprofessional and not at all an environment in which to enjoy a nice meal .. certainly didn’t make us want to return. Food was good but atmosphere poor and to top it off we had fruit flies joining us for the meal.

site_logo

clare957 . 2018-10-07

MORE AT TripAdvisor

Came across this little Thai restaurant right on littlehampton pier. It seemed warm and welcoming so thought I would give it a try. Service was great and food was amazing! The price was decent and the portions were generous and staff were polite and so helpful. With a table of 9 they handled us all great.

site_logo

Godingi . 2018-08-27

MORE AT TripAdvisor

Having had several takeaways from here, we decided to go mad and have an evening out!

site_logo

ComeonAugust . 2018-08-13

MORE AT TripAdvisor

We really fancied a Thai takeaway tonight but when ordering from The Lemongrass they had no delivery drivers....so we ordered from this restaurant in Pier Road which we have used before but not for a long time.

site_logo

bridgetcafe . 2018-08-11

MORE AT TripAdvisor

Having had several takeaways over the last year which were very good we popped in for lunch the other day and had the most wonderful meal. It was beautifully cooked and having it straight from the kitchen it was even better. Will definitely come back for lunch. Kevin the owner was extremely friendly and helpful.

site_logo

FrequentFlier810090 . 2018-06-13

MORE AT TripAdvisor

Another fantastic meal at the Thai kitchen. Food is always fresh and absolutely the most authentic Thai food locally. Tremendous

site_logo

mike b . 2018-06-08

MORE AT TripAdvisor

Been eating here for 15 years.All the ambience and authenticity has gone.Service was abysmal carried out by inexperienced untrained staff.We had to clear our own table(watched by the owner or manger) after our starter having waited for ages for staff to clear.What has happened to the Thai ladies in thier beautiful traditional dress.

site_logo

Allan M . 2018-05-20

MORE AT TripAdvisor

A quiet night with just three tables of people resulted in an unnecessarily long wait for the food. The restaurant has little in the way of atmosphere but the food when it did arrive was not bad at all.

site_logo

Tigger_Coco . 2018-04-23

MORE AT TripAdvisor

Visited on an unseasonably warm evening in April and enjoyed a tasty, well presented meal. Extensive menu with a variety of dishes to suit all palates. Waitress very welcoming and efficient.

site_logo

Abraham45 . 2018-04-22

MORE AT TripAdvisor

I love Thai food and came here with a friend that lives locally. I ordered my two favourite dishes and was disappointed with both. I had Thai soup with prawns, and whilst it had a fairly good flavour it was wishy washy as if it had been watered down. Maybe they were running out and added more water to make it go further. My main problem was with with my main course. I ordered a Thai green curry. The menu stated the usual ingredients, including aubergine. When it arrived there were no aubergines in it, I asked the waitress and a English man came to the table. He said other people had complained about the aubergine going mushy. I said baby aubergines don’t go mushy, to which he replied “we don’t use those, they are too expensive”. So why list something on the menu and then don’t give it to your customers? Expensive for what we had. Pleasant service from the young lady that looked after us.

site_logo

UK-Pegasus . 2018-04-01

MORE AT TripAdvisor

I would come here again, good service, great food and on time. Parking out the front if you are lucky...we were

site_logo

Greggez . 2018-03-29

MORE AT TripAdvisor

Good Food. Lovely staff. With a cosy casual atmosphere. Could'nt fault it. Would go again. Good value.

site_logo

sue d . 2018-02-22

MORE AT TripAdvisor

Been coming here for years and food consistently good with some different dishes that have not seen at other Thai places. Service however is poor and disinterested and the general decoration is very poor and really needs some TLC badly. Hazard tape stuck over windows,...

site_logo

341spudulike . 2018-01-22

MORE AT TripAdvisor

Another tasty meal here. Starters all good. Red wine was rather cold.. odd! Otherwise... great. Will always come here.

site_logo

pointsslave . 2017-11-02

MORE AT TripAdvisor

Visited again and was still impressed not only by the food but the hospitality shown to all, when I visited they had shown great compassion to a gentleman of the road and made sure he was fed and watered. This says it all really about...

site_logo

terryellis . 2017-10-02

MORE AT TripAdvisor

Since I was last here the menu has changed a bit, for example my favourite pork and crab sausage is now available on the great choice of starters, yippee! We had a lot of starters, love lots if them on the table and everyone dipping...

site_logo

pointsslave . 2017-09-12

MORE AT TripAdvisor

We came without a booking and fairly late (9 o'clock) but the staff were friendly and accommodating. The food was excellent and the "son in law eggs" intrigued me so I had to try them. They were delicious!! We will definitely go back when in the area again!

site_logo

cutters076 . 2017-09-08

MORE AT TripAdvisor

Este es un viejo favorito que no han ido a por un tiempo como nos trasladamos a casa. Francamente, el exterior está un poco cansado, pero la comida está muy lejos de ella. Magnífico, curry y patatas fritas stir fideos en una ambiente agradable, ayudados por el personal servicial y muy agradable. El chef/propietario ha estado allí por 10 años y ha mantenido un nivel excelente. Nuestros amigos nos encantó también. No puedo esperar a volver.

site_logo

MajorCityTraveller . 2017-07-13

MORE AT TripAdvisor

Estábamos buscando un restaurante tailandés en martes (23 / 5) y fuimos a la cocina tailandesa. . . . ¡Dios mío! La comida es excelente. Si estás en cualquier lugar cerca de Littlehampton vale la pena un viaje sólo para la comida.

site_logo

Olive62 . 2017-05-25

MORE AT TripAdvisor

Nos las arreglamos para conseguir una mesa sin reserva, aunque parecía un lugar concurrido. Fuimos con nuestro 19 meses y eran muy complacientes con un asiento de seguridad. No era muy amplia, así que era un poco estrecho tener el cochecito con nosotros. La comida era muy buena, las porciones son grandes no podíamos terminar a pesar de ser deliciosa, el personal era amable y educado. Nuestra camarera era precioso y estaba preciosa con mi niña.

site_logo

miss_anticipated . 2017-05-16

MORE AT TripAdvisor

Este pequeño restaurante con vistas al agua fue elegantemente decorado, el servicio era fantástico, la comida deliciosa y bien presentada, y el precio razonable. Un almuerzo de lo más agradable y volveremos!

site_logo

susanne d . 2017-04-26

MORE AT TripAdvisor

Pequeño y encantador restaurante tailandés al otro lado del río Arun en Littlehampton. Visitamos con mi pareja y el personal encantador. Estaba un poco preocupada porque me gusta mucho el lugar pero Rustington competidor tailandés en Cocina Tailandesa era fácilmente como una buena comida de calidad. Restaurante muy acogedor y con buenas opciones de menú.

site_logo

Lizzie S . 2017-04-16

MORE AT TripAdvisor

Went for a Pad Thai whilst staying overnight in Littlehampton. Quiet on a Monday night. Restaurant located by river front/ estuaryFood was good portion. Price was very good value for money. Recommended

site_logo

m888lim . 2017-04-13

MORE AT TripAdvisor

This tiny Thai restaurant was full and busy on a Saturday even in early February. The food is very average - little skill in presentation, and our main courses were flavoured only by the sauce - of which there was a great deal. However, the meal was not expensive, and the service was very good and friendly.

site_logo

Susan B . 2017-02-14

MORE AT TripAdvisor

Had an evening meal here on a Saturday night and the place was empty. We were a bit dubious as often if somewhere is empty it means the food is naff. On the contrary, we had a mixed starter which was huge. I don't usually eat calamari as it is chewy but this was yummy. Fresh and tasty batter. Mains were just as good. Staff were friendly and attentive. Would definitely come back. Just a shame it wasn't busier for them.

site_logo

Tina B . 2017-01-28

MORE AT TripAdvisor

Really comfortable and friendly restaurant with a great range of food.I kept.it simple with a pud Thai and a beer, my benchmark for a Thai restaurant. It was fresh, authentic and really enjoyable.

site_logo

GentlemensCurryClub . 2016-12-28

MORE AT TripAdvisor

Fantastic thai food considering the price. Thai is often a slightly more expensive meal out but the price reflected the quality here. The service was efficient and the place is small and intimate with a lovely atmosphere once it's filled up.

site_logo

Lizzie S . 2016-11-29

MORE AT TripAdvisor

Visited on a quiet Friday Lunchtime using a local radio voucher. Lovely view of the river from the window tables and polite, friendly service. Attractive surroundings, white linen tablecloths, very reasonably priced wine and food. Enjoyed both delicious starters and tasty mains. All the food was flavoured to perfection without being too spicey and/or hot. Definitely recommend!

site_logo

jne2647563 . 2016-11-19

MORE AT TripAdvisor

The £5 noodle boxes made an excellent take-away lunch. Thoroughly recommended. Nice people as well. I will definitely be going there again.

site_logo

John L . 2016-10-21

MORE AT TripAdvisor

Visited Tuesday evening and reasonably quiet. But food was hot and tasty, didn't take long to arrive, and compared well to other Thai restaurants. I too always have the Pad Thai as a benchmark; it was very good if a little dry. Curry was good too, as were the prawn spring rolls. Staff were fine, two lads, one obviously training.Located on the river front (no view) and in the winter months you can park outside on the yellow lines. Will definitely be trying it again.

site_logo

don m . 2016-10-20

MORE AT TripAdvisor

Monday night in Littlehampton has a limited selection of places that are open however Thai Kitchen was. Don't be put off by the ice cream dispensary entrance this is a great little restaurant. The owner's Thai wife is an excellent chef and cooks everything from scratch so expect to wait 20 minutes or so, but it's worth the wait. Starch linens and napkins are a pleasant change for once.

site_logo

zsamot . 2016-09-12

MORE AT TripAdvisor

Came in here on my own just after 6pm on a Sunday, I think they were a little surprised to find out that I wanted to eat in alone, but the service I got was lovely. Lovely staff, and even better food. I had the vegetarian jungle curry and it was really tasty. The only downside was a slight sewer smell in the dining room.

site_logo

Wendleton . 2016-09-04

MORE AT TripAdvisor

Can't complement enough, really tasty food, we had pad/pud Thai, green chicken curry so we could bench mark against others! Really tasty!

site_logo

David M . 2016-08-30

MORE AT TripAdvisor

Visited on a Tuesday evening. Long wait for food granted cooked fresh but still over an hour between starter and main excessive! No1 came to clear our starter plates for a good hour. When asked the girl how much longer she told me were busy..... and then proceeded to deliver the wrong food to us. When I then asked how long my correct meal would be she told me 5 minutes. Asked for the bill with taste card discount and queried why only 1 course taken off bill very rude answer and she spoke 2 me like I was stupid. No apology for the food taking so long no smile nothing. Would want her working for me personally.... her and the other waiter had plenty of time to stand behind the counter chatting. Shame as the food was nice but service massively let's this place down won't be going back!

site_logo

Jezzzza_S . 2016-08-29

MORE AT TripAdvisor

This restaurant was a great find. The food was absolutely yummy.The service was excellent and we had a lot of different dishes together with a decent bottle of wine.This place is excellent value for money far cheaper than you would expect.I even thanked the lady chef when we left .

site_logo

Teljean . 2016-08-24

MORE AT TripAdvisor

Such. Pity that the staff are so disinterested. We were one of two tables at lunchtime. No welcome , no interest. Good food cooked as hoped but this was so much better a year or two ago when the ladies ran it and welcomed everyone properly. Just compare with The Thai restaurant in nearby Rustington Sad

site_logo

visitoruke . 2016-08-20

MORE AT TripAdvisor

This is local for us, but we have not been for a while, the food was excellent, you may have to wait a bit, but each dish is cooked fresh, the portions are a great size and reasonably priced. The staff are friendly and helpful, it is spotlessly clean. During the day it doubles as an ice cream shop (it faces the Arun river, and is close to the beach) and also sells noodle boxes for snacks. Great place will be going again.

site_logo

amfra13 . 2016-08-19

MORE AT TripAdvisor

A very relaxing meal here, superb food and excellent service. The decor looks a bit tired, however, do not hesitate to enter and enjoy an inexpensive meal.

site_logo

MB201065 . 2016-08-15

MORE AT TripAdvisor

Never eaten in here, but loving the ice creams. For £1.50 you can have a double cone ice cream with 2 scoops of different ice cream. They have sold out of some of the flavors which is sad as they were really tasty, but getting new flavors in soon.Owner is really friendly and willing to keep us updated. They also sell drinks and beers at a reasonable £2 a can, which is useful if you want alcohol with your chips etc.

site_logo

BargeeGirl . 2016-08-14

MORE AT TripAdvisor

We go to this restaurant every time we visit Littlehampton and have loved the food every time. It's true that the food can take a while to arrive, so it's worth factoring this in to your evening out. Our party were a family of four, so my husband took the kids for a stroll along the river while I scoffed the prawn crackers. Service was friendly and attentive. The food, in my opinion, is very good: delicate flavours and a well balanced combination of ingredients. I ordered the steamed sea bass in ginger, husband had a beef soup and son in law eggs, kids both loved the chicken wings and sticky rice. Very happy.

site_logo

Spixblue . 2016-08-02

MORE AT TripAdvisor

Another favourite restaurant in Littlehampton overlooking the yacht club. Very small but the food is wonderful. Great for diabetics as the food does not affect sugar levels etc. Middle of the road prices, friendly staff and food cooked to order - a real taste of Thailand in a nice corner of Littlehampton.

site_logo

Madeleine D . 2016-07-25

MORE AT TripAdvisor

This restaurant never disappoints. We have been visiting for many years and the food is very tasty and well-presented. It is also good value for money. We shall be visiting again soon!

site_logo

epsomlady . 2016-07-02

MORE AT TripAdvisor

Went for a lunch,there was 4 of us and another group of 4 in restaurant. Waited nearly an hour for lunch but it was well worth the wait. Will def go again

site_logo

fozzie1105 . 2016-06-02

MORE AT TripAdvisor

Second time here. Ordered the chicken wings in rich sauce, son in laws eggs, mixed starters and the special crab curry. All amazing, tasted great. Took a while to understand my request for prik nam pla, but we got there. I think it would be nice if they had condiments on each table with extra chilli flakes, fish and chilli sauce. I like my food THAI hot! This is now my favourite Thai restaurant, Cant wait to return, I like the fact they have authentic dishes and not just the 'English Thai' dishes. Brilliant place.

site_logo

FoodiePortasalade . 2016-05-27

MORE AT TripAdvisor

We love this local restaurant and visit regularly. Really good food with loads of choice, well cooked and presented with pleasant staff. Good for diabetics - a friend we took reported no adverse effects whereas with chinese or indian usually has blood sugar problem.

site_logo

Madeleine D . 2016-05-03

MORE AT TripAdvisor

Travelled from Worthing on a recommendation for this restaurant. When we arrived we were disappointed to find the place was closed Wednesdays. However the chef still invited us in and cooked for us. How very kind indeed. We had an amazing selection of dishes and I especially enjoyed the pepper sauce wings and also the Son in Law eggs, which were incredible. All washed down with a great Chenin Blanc. The bill was very low, and I thought we hadn't paid enough. Will be returning soon. I want to try all the dishes! So far, my favourite Thai in West Sussex, beats any in Worthing and Brighton. 10/10.

site_logo

HoveWine . 2016-04-21

MORE AT TripAdvisor

We decided to give the Thai Kitchen another go as we have visited several Thais in the area and compared to the Thai Kitchen there rubbish.the meal we had was wonderful flavoursome hot and authentic beautiful meal see yo next week

site_logo

melanie h . 2016-04-21

MORE AT TripAdvisor

Another great meal at the Thai Kitchen in Pier Road. Went for a stroll along the harbour wall and couldn't resist popping in. Luckily they had a table for the three of us. We've been three times this year and I have to say each visit is better than the last. The secret is in the chefs extensive experience, according to the owner, and he should know because it's his wife! Thai food at its best, and it's in Littlehampton! Not known for culinary excellence! Location is great and the summer people watching along the promenade on a balmy evening would be most enjoyable.

site_logo

mike b . 2016-04-09

MORE AT TripAdvisor

Went here last night because we couldn't get in to The Gravy Boat. Has been a couple of years since we last went to this restaurant and we met the owner, who was very pleasant and his wife is the main cook. Don't be put off by the décor as the food is fab. We wanted to try lots of different bits so ended up ordering the two platters on the starter - the Combo Platter is enormous! After that, my husband had the Drunkard Noodles and I had the stuffed omelette - all very tasty and good value for money.

site_logo

4Springers . 2016-04-06

MORE AT TripAdvisor

We walk past this place every Sunday when we enjoy a walk on the sea front. On arrival we was greeted by a friendly member of staff who directed us to our table. The take a way collection side was busy and it felt as if the attention was directed at that as it took 10 minutes to get a drink order and a menu brought to the table. The restaurant itself is a lot smaller inside than it looks from the outside. The food we ordered and the other food we saw other customers eating looked very nice and ours was very good indeed. The wine list was basic but very reasonably priced and my pint came from a can although I think a can is better than draught in a restaurant of this size. The sea front has had defence work done which has robbed the place of a view. Big question would I come here again -- YES I would if anything its GOOD FOOD.

site_logo

taj552015 . 2016-03-16

MORE AT TripAdvisor

We had the starts, chicken satay and my husband the fish cakes. Looked too perfect to be home made. Clearly bought in frozen. Lacked depth of flavour. Pleasant but nothing wow. We both had the green curry for mains. Mine chicken and my husband prawn. Although clearly the same Sauce with the fillings added after it was outstanding. Real flavours. Service was outstanding, friendly and attentive.

site_logo

Fiona1812 . 2016-03-15

MORE AT TripAdvisor

Having just come back from Cambodia where my taste buds were challenged!!! I thought I would try these strangely named Son in Laws eggs on my first visit to this restaurant in the banks of the Arun in Littlehampton. Pleasantly surprised by the dish, although it's more of a starter for two, than a main dish. The rest of the food was very good and the staff were very good and attentive, even though one of the young girls had only started a week or so before. Good Thai experience and recommend.

site_logo

Richard E . 2016-02-27

MORE AT TripAdvisor

We booked late in the day on a whim and i must say we were not disappointed the meal was lovely and would go back again

site_logo

roger l . 2016-02-14

MORE AT TripAdvisor

I understand that they'd recently been taken over and sadly the food and service has rather gone downhill. We had to ask for them to take our drinks and food order. We also had to ask for some crackers. The starters were a real disappointment, everything (apart from the dim sum) had obviously been deep fried in rather old oil and were a bit grim (we didn't finish them). The mains were ok, quite nice curries and rice but nothing tastes really fresh like it used to. The Thai staff were perfectly pleasant but it appears to be managed by a rather odd English chap who was dressed in an ill-fitting jumper which made home look like he had just come off his fishing boat. He wandered around rather ineffectually, not really sure what he added. All a bit disappointing, we really used to enjoy eating here. Much better Thai food is now available at the Lemon Grass in Rustington. Sadly they were full so we couldn't get a table.

site_logo

Fatboynumber1 . 2016-02-06

MORE AT TripAdvisor

Ordered a take away for 8 people and the two lovely ladies helped us to choose the best value dishes. Doubling up on a set Neal for 4 would have cost 170 odd quid. Carefully choosing from the menu we spent 74 quid and they threw in s free drink for my wife while we waited. Plenty of delicious food for 8 of us and some left over. First class!

site_logo

mike b . 2016-01-09

MORE AT TripAdvisor

The restaurant is located on the newly redeveloped river-front, and the food, staff, and service is always top-notch.It is a family run business of a good many years standing, and the family, plus staff, are very friendly.

site_logo

kab417 . 2015-10-28

MORE AT TripAdvisor

Great authentic thai food. The owners have changed but the chef remains. The service is better than previou owners.

site_logo

grooveychick . 2015-09-15

MORE AT TripAdvisor

Lovely meal at the end of the day. Food was really tasty and filling and good value - drinks were also reasonably priced. Staff were very friendly and welcoming.

site_logo

Heather M . 2015-09-10

MORE AT TripAdvisor

The Thai fish cakes were anything but fish, disgustingPrices were cheap but you only get average food

site_logo

John E M . 2015-08-11

MORE AT TripAdvisor

Came here on a busy Friday night last week, was waited on by 2 lovely young women and a kind young gentleman who were all extremely polite, attentive and cheerful which added to our evening. The food was of incredible quality and presented beautifully. I don't know why people are complaining about the service because it seemed wonderful to me.I highly recommend a visit to this restaurant and I will definitely return.

site_logo

Stacey b . 2015-06-26

MORE AT TripAdvisor

looked quite pleasing to start off with but the first thing we noticed was the service. it wasn't exactly the best I have ever seen. it was good and the staff didn't seem to care about our personal requests. They seemed to not have any enthusiasm. the second thing was the atmosphere. it started of fine but after a while it just became uncomfortable. and the third thing is that the food took so long for a pretty average dish. The thing that shocked me was that it took an hour for our food to come and there was just seven tables so it was very unimpressive. all and all it was disappointed.

site_logo

JJH23 . 2015-06-22

MORE AT TripAdvisor

Having been customers of this restaurant for some years under the old owners we were very very disappointed at the change in the place. Our family of 8 went there for Fathers Day lunch. Service was awful drinks forgotten, wrong drinks, wrong size drinks. We waited an hour for the meal to start arriving. Each plate was delivered one at a time, with up to 5 minutes between each even when the order was the same. The ambiance was less homely and the staff seemed unhappy. I'm afraid we will never go there again.

site_logo

Charles C . 2015-06-22

MORE AT TripAdvisor

we have been going to this restaurant for the last 12 years and up till last year it was the best,sadly under new management we have watched the demise of this quaint friendly exquisite food go to slow service,rip off prices,portions shrinking and quite frankly not very good,Julie and tui would be so upset to see this, such a shame we won't be using it again yet another good customer moving on

site_logo

melanie h . 2015-06-14

MORE AT TripAdvisor

Went here with a friend for an evening meal. For a Friday night it was quiet but the location is lovely particularly on a summer evening. The staff were very attentive and helpful. I had chicken satay to start...was a little dry but still very tasty and my friend had the dim sum....both large portions which neither of us finished. For our mains we had chicken with cashew nuts and a veg noodles.....both again large portions which we could not finish. The quality was excellent...perhaps a little on the pricey side but Thai is slightly more expensive.

site_logo

mils1964 . 2015-06-04

MORE AT TripAdvisor

We have been coming to the Thai Kitchen for over 5 years. Under the previous owner, who sadly returned to Thailand just over a year ago, the service was very friendly, the food was excellent and you left feeling that you had had a really good meal and experience.Sadly since the new management took over the service has become increasingly slow. We have been returned a few times thinking we would give them the benefit of the doubt. However last night we got to the restaurant at 7.15, by 8.20 we were still waiting for our starter no apology had been offered for the delay. It was not exactly busy, our table of 4 plus one other of 4 and a single diner. We finally got up and left at 8.30 leaving a token for our drinks. From recent experience you only go to this restaurant if you are not feeling particularly hungry but think there is a chance you might be an hour or so when you food might possibly arrive. I'm afraid we will now be going elsewhere!

site_logo

Talitha B . 2015-05-27

MORE AT TripAdvisor

Nice meal beautifully presented, chilled delicious wine, plenty of polite authentically dressed staff. We had not booked a table but it was not a problem. The restaurant had quite a few diners already enjoying their meals. The atmosphere was cosy and relaxed, the service was good. The waiter helped with the choice of food. The waitresses were pretty cheerful and attentive. We were most impressed with the table linen, crisp and clean, which is something we look for when dining out. Overall the experience was very good and will be using the loyalty card again! The Jones's

site_logo

ShirleyJ2013 . 2015-05-03

MORE AT TripAdvisor

Sunday evening 15.3.15, a quaint place with a comfortable ambience. We went straight onto ordering vegetarian main meals and were happy with the varied selection of vegetarian dishes. I am slighty fussy, and the staff were very obliging when I wanted to omit specific ingredients, and they happily added extra cashews into the Massaman curry we ordered. The Pad tai was tasty, all the vegatables in all the 3 main dishes were fresh and juicy, the coconut rice was just right, not forgetting the jungle curry that was as hot as my date.Alas no Thai crackers on the table.The portions were large and the staff boxed up the leftovers. We left as happy Thai diners. Suze & Alex.

site_logo

Alex-Suze-Thaioff . 2015-04-09

MORE AT TripAdvisor

Similary restaurants in South East

restaurant_img
4.5

431 Opinions

location-iconChurchill Parade
Thai
outdoor_seating_170332takeaway_170332delivery_170332

Muy ocupado cuando llegamos, pero sentaron inmediatamente. Superar por calor y el ambiente local, algunos jóvenes escandalosos en la noche. No Des e ' Lynam 1989así que él debe haber peldaño por delante. La comida era buena pero de prisa, y la mesa de al lado era tan escandalosa que nos rendimos a gritos y nos sentamos en silencio, bebiendo singha. Para rematar todas las ventanas firmemente cerrado durante, recordó que tanto la izquierda y algo sobrecalentadas, y aturdidos, pero 60 libras más ligero, por toda la experiencia.

restaurant_img
4.6

600 Opinions

location-icon73 High Street
Thai
outdoor_seating_142902takeaway_142902delivery_142902

I visited with a group of mates and we had an excellent meal. The staff were lovely and the food was delicious. Thanks for a great time!