GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.9

Based on 307 opinions finded in 1 websites

site_photo4

Nº 268 in 3448 in Manchester

CUSTOMERS TALK ABOUT DISHES WITH..cookedsoupsporkchickenchilliprawnricespicymustgingersoupnoodleslady
Score
OpinionsNoteGoogle3074.9

comment_iconOpinions

Mixed meat noodle broth and vegetable noodle broth. Both fabulous dishes. Served traditionally on a sharing table. This is real street food at its finest. Excellent friendly service and a north that packs a punch

site_logo

Jason Jennings . 2024-11-25

MORE AT Google

Me and my wife just finished shopping and we were hungry. As we walked into town from near Asda we smelled something really good. Then we found out it was this place called Rabbies! The name may not sound it but it is a Thai food stand with dine in and of course take away options. Upon entering the little shack we were met with great hospitality and a broad explanation of the menu, which was awesome because we are unfamiliar with Thai cuisine. Then we sat down and ordered our food, waited a couple of minutes (we could see the lady cooking! 😋) it was very quick to arrive to our table! The portion sizes were very generous for the price which was great, the presentation was fantastic as well, as you can see the meals looked appealing and the flavours were good too, great for British people that cannot tolerate spicy food. The spicy stuff is all on the table for who ever can! I would recommend this place to everyone who wants a warm meal in a cozy little restaurant in the middle of the town centre!

site_logo

Samuel J. de Heer . 2024-11-18

MORE AT Google

The food is always amazing! Tasty, delicious and proportion is great! No matter the dish you choose, it will be worth it! Real taste of Thailand! Plus they’re all super nice 👌🏾

site_logo

Ceecee lb . 2024-11-12

MORE AT Google

Second time eating here for takeaway. Each meal has been amazing Had the recommended dish which was pad Thai, I believe it was jungle chicken and it's amazing

site_logo

Adam Gray . 2024-11-11

MORE AT Google

Lovely food. Maybe some of the best Thai food I've ever had. Too bad I live in Denmark or else I would be able to eat there more often

site_logo

Søren Mortensen . 2024-11-08

MORE AT Google

The food is outstanding, the staff are super friendly. Best place in town

site_logo

Sarah Stainer . 2024-11-06

MORE AT Google

Been here a few times and never fails to surprise me with the taste of the food

site_logo

Hit Man H . 2024-11-06

MORE AT Google

Honestly the best Pad Thai I’ve ever eaten. Served by lovely people too!

site_logo

Edyta Krawczynska . 2024-11-02

MORE AT Google

Food served is delicious 😋 😍 Would definitely go again

site_logo

Francisca Fernandes . 2024-10-30

MORE AT Google

My mouth starts to water the minute I know I'm coming over to Wythenshawe! The food is always amazing, the staff just lovely, accommodating and they take multitasking to another level! You can’t be disappointed by a visit here! Recommend to everyone!

site_logo

Dayna cooper . 2024-10-24

MORE AT Google

Grilled chicken with Jasmine/Ginger rice is excellent. It has become my family's every Saturday lunch. Thank You.

site_logo

Gourav Sarkar . 2024-10-23

MORE AT Google

Have been a customer for almost 3 years now and the taste it’s just getting better and better. I consider it a treat on my days off together with my family when we go to civic center. Taste, serving more than satisfying.

site_logo

Ana Nelca Colina . 2024-10-23

MORE AT Google

Beautiful food made as it should be excellent service everyone made to feel welcome can not recommend enough love this place

site_logo

Jackie Hall . 2024-10-22

MORE AT Google

Absolutely stunning food , always fresh and flavourful

site_logo

Sue . 2024-10-16

MORE AT Google

Absolutely love this place great food, lovely staff, real value for money can't recommend it enough x

site_logo

Jade De Lury . 2024-10-15

MORE AT Google

What a little gem of a place. The food is proper authentic and delicious it has such a cool vibe. Great service and great prices,a hidden gem for Whythensawe. Will be back anytime I'm in the area.

site_logo

Christopher Hough . 2024-10-14

MORE AT Google

Worth to travel to, £8 each, big portion, authentic taste and full of meat!

site_logo

May Auisakul . 2024-10-13

MORE AT Google

My wife is Thai and we’ve lived in Thailand. This is some of the best Thai food you can get in the UK. Amazing value too, big portions

site_logo

Blair McKinlay . 2024-10-12

MORE AT Google

Good place to eat the food was amazing and the workers are very nice and made the food very quick. Also the seating area is very good and comfortable. 😄

site_logo

Norijus Palubinskas . 2024-10-09

MORE AT Google

Fantastic food and absolutely lovely staff and management

site_logo

Imran Hassan . 2024-10-09

MORE AT Google

We really liked the food and the warmth….

site_logo

Curly Talkz . 2024-10-04

MORE AT Google

Delicious pad thai and friendly service.

site_logo

Chaotix D . 2024-09-28

MORE AT Google

Grilled chicken pad Thai is the one. Massive portion & best pad Thai I've had in ages.

site_logo

Conor . 2024-09-27

MORE AT Google

Great food and friendly service. I recommend it!!!!

site_logo

Aleksander Bazylewicz . 2024-09-27

MORE AT Google

Amazing food, excellent customer service! Highly recommended ❤️

site_logo

Mobile Tyres in partnership with Mr Tyres ltd . 2024-09-26

MORE AT Google

Can’t fault the food one bit. Always cooked fresh in front of you and the taste compliments that would 100% recommend and will be going back

site_logo

Matt Wilson . 2024-09-26

MORE AT Google

Really friendly staff food is always fresh and hot pad Thai and beef noodle soup is lovely highly recommend this place

site_logo

Danielle Smith . 2024-09-23

MORE AT Google

I never leave reviews, but this is wholeheartedly due. Once you've tried the food at Rabbie's noodle hut, you'll be making a regular visit. Mike & Rabbie have put so much thought and care into this humble noodle shack. You can literally taste all the goodness in their food. They use good quality meats too. The chicken isn't the type that's been artificially injected (plumped up) You can taste real chicken! The prawns are huge and juicy. The level of flavours and homemade dipping sauces are sublime. We especially purchased large ramen bowls to have at home for when we pick up Rabbies' noodle soups to take home 🍜 Nothing is ever spoiled in transit. The noodles are always thoughtfully packaged separately from the soup to avoid them going soggy. If you eat inside Rabbie's shack, it's relaxed,comfortable & cosy. There's an array of authentic sauces on the tables inside. It's like being transported to another destination. There's a good selection of soft drinks too ,which includes Jamaican ginger beer. Our favourite! Rabbie's homemade chilli sauce is a perfect accompaniment to add heat & another depth of flavour to taste. Also her homemade ginger sauce which accompanies the chicken Hai nan, or beef flank with ginger rice is delicious too. Alternatively, there's fragrant jasmine rice. The noodle soups include authentic ingredients. Mouli radish (which absorbs all the natural flavours of the soup). Meat balls, & Asian cabbage which has a lovely light crunchy texture. We alternate between regular soup & Tom Yum. Both are equally as good. You can choose your protein in each dish from Tofu, prawns, chicken, beef, pork, or choice of mixed meats. Or you can choose vegetables only. I highly recommend Pad Thai, Noodle Soup, Tom Yum noodle soup, Hai nan, beef flank with ginger rice. Chilli dipping sauce.

site_logo

Lisa Aston . 2024-09-21

MORE AT Google

Mike and Rabbi always make wonderful food and they have a great atmosphere! I can highly recommend them whether you have tried Thai food or not! But you'll have to get there early if you want the special chicken!

site_logo

Sharprocox . 2024-09-20

MORE AT Google

Great food , with authentic Thai flavours. Service is always stellar as well

site_logo

Joel Boggiano . 2024-09-20

MORE AT Google

Great wee place. It was very busy when I was there, but the boss was doing his best to keep everyone happy and updated. I had the beef noodle soup, which I pimped with a good amount of their excellent home made chilli sauce. I look forward to them expanding their site as clearly the demand is there.

site_logo

Lee Freedman . 2024-09-20

MORE AT Google

This food will blow your trackies off!

site_logo

Jason Major . 2024-09-20

MORE AT Google

Amazing food and incredible team, I've never left hungry and always want more again and again, if you are ever in civic wythenshawe come here and get some delicious food seriously!

site_logo

AceyMGames . 2024-09-20

MORE AT Google

Authentic Thai food. Best test, well enough portion and very reasonable prices. We tried Pad thigh (grilled chicken and noodles) and Noodles with Soup (prawn). And can't get over it. Yummiest and served with such love and happiness. We told Michael that it was our first attempt to Thai food and he went above and beyond to explain what he tend to add to the food and what is what. He explained it so politely and in a frank manner that we didn't feel awkward not knowing much about the terminology. All freshly made. We loved their self prepared chilli sauce. Will definitely come again with our children too. Lovely environment.

site_logo

Gulnar Sohail . 2024-08-31

MORE AT Google

Food was fresh and very tasty Authentic Thai food.

site_logo

Hayley C . 2024-08-30

MORE AT Google

Great personalised service with chatty people. Understood i was on my break at work so made sure i wasn't waiting too long. Theres a reason they are busy - because it's some of the best food i've had and for between £7-£10 you wont find anything better nearby. Gutted I'm only here for the week or i'd have it every day! Everyone at work asks what i get and says it smells so good, keep it up!

site_logo

Tabby Shaw . 2024-08-24

MORE AT Google

I grabbed a Grilled Chicken Pad Thai for lunch from here. Absolutely excellent, definitely will be going back.

site_logo

Paul . 2024-08-19

MORE AT Google

Top tier service! Recently came back from Thailand and was missing the food so I stopped by Rabbies, so so glad I went as it was very authentic and delicious! Lunch times are very busy, so either order ahead or head over after 3pm, I went at 2pm and waited only 20mins for takeaway which wasn’t bad at all! Going to 100% visit again!

site_logo

Faisal Ali . 2024-08-06

MORE AT Google

Wow ....This place is a gem!!!!! Absolutely delicious food and a great and friendly atmosphere. We will definitely come back next time.

site_logo

Anna Doringer . 2024-08-05

MORE AT Google

Stunning Thai food. The Hainan Chicken Rice was a very large portion and served with ginger rice. The special soy sauce was incredibly tasty, elevating the whole dish to another level. The beef brisket was so tender, and combined with the tom yum soup, I can say this was the best boat noodle I have had in the UK.

site_logo

Lavanna Purpura . 2024-08-03

MORE AT Google

The awesome taste of Thailand in Wythenshawe, authentic flavours, large portions, excellent customer service ! The grilled chicken pad Thai was phenomenal, I'd advise adding a few dashes of the ginger soy sauce to take the unami flavourings to the next level. If you visit this place spread the love with a review it's a real entrepreneurial foodie experience and they deserve the hype !!

site_logo

Damon Atkinson . 2024-07-30

MORE AT Google

Outrageously good. Huge portions. Amazing value. So tasty. Please don't go, so that I can have your seat.

site_logo

Jim Davis . 2024-07-26

MORE AT Google

Incredible food, impressive portions, and lovely staff for extremely reasonable prices. Authentic food and atmosphere. The prawns were huge!!

site_logo

Hannah Senior . 2024-07-24

MORE AT Google

Can't say anything other than wow. I'd seen a video about it a few weeks back and meant to go since. I had Thai food elsewhere last night and then had the pad Thai from Rabbies today and it was a different level. For the portion size and the complexity of flavours I can't believe it's as much as getting a McDonald's meal haha, best food shack of all time. Easily 11/10 without even trying, id say a top 3 meal I've had this year, will be back very soon!! Sorry my pic doesn't do it more justice but that was £8!!

site_logo

JohnnyDM . 2024-07-14

MORE AT Google

I've tried the noodle soup and the pad thai. Both exceptional.

site_logo

Shaun Hickey . 2024-07-13

MORE AT Google

A thai’s soup noodles you always think of in the MCR

site_logo

Nick C . 2024-07-13

MORE AT Google

Ever since I found Rabbie's Noodles during Covid way back when, I have been sharing the joy I felt with anyone who would listen (and dropping by for food whenever I'm local). Colleagues started going, friends advised to drop in on the way to/from the airport, I even met a lady on a plane who told me she lived just outside Wythenshawe, quick get yourself down to Rabbies and eat great food, cooked in true Thai traditional ways with super fresh ingredients. Today I have taken my friend who had just arrived in from New York to sample some awesome food. We weren't disappointed. Rather than take away we chose to sit. Rabbie cooked up fabulous food, I had prawn pad thai and my friend the chicken. The business started in a tiny home built hut in the centre of Wythenshawe with a couple of outdoor stools and has now moved to a bigger hut with tables and chairs to eat inside Rabbie cooking and her partner doing everything else. I could really see their business expanding even further, maybe even into a bricks and mortar restaurant with the right investment. They are a lovely couple, they serve great food, you may have to wait a little while to eat but it's well worth the wait. Get down to Wythenshawe as soon as you can.

site_logo

Judith Braithwaite . 2024-07-12

MORE AT Google

Fresh food,every time. lovely, friendly owners

site_logo

Sarah Staunton . 2024-07-12

MORE AT Google

*Best Authentic Thai Food Experience* Rabbie, Mike and the team work very passionately to bring the best in Thai food to Wythenshawe. I have been back here many times and it is my clear favourite. Chicken Pad Thai was my regular choice until Rabbie introduced me to the Tom yum noodle soup of which is incredible! The only downside can be high demand times where a bigger premises would be an advantage. Great value for money portions freshly cooked. I highly recommend!

site_logo

David . 2024-07-11

MORE AT Google

Best pad Thai and chicken noodle I’ve had very nice people

site_logo

Elitedogz 11 . 2024-07-11

MORE AT Google

A real random gem in Wythenshawe. Food is amazing. Service with a smile. You will not be disappointed!!

site_logo

Eleanor King . 2024-07-11

MORE AT Google

Foods are awesome with big portion and their service is excellent too... Highly recommend

site_logo

Debbie Leung . 2024-07-11

MORE AT Google

Excellent food and the owners are very friendly and efficient best food in civic for sure

site_logo

wendy drennan . 2024-06-29

MORE AT Google

Great food and service...also good price and a hefty portion :-) it was a bit of a wait but it's worth it :-)

site_logo

Every dog and his man . 2024-06-29

MORE AT Google

Absolutely amazing food. The best beef noodle soup I’ve had in Manchester. The owner and staff are so friendly. Very affordable. Visiting at least one per week.

site_logo

Steven Yeung . 2024-06-23

MORE AT Google

Their pad thai was quite possibly the best I've ever had. Not only that, the portion sizes were also huge, so you get amazing value for money. The service was great as well. The staff were friendly and attentive.

site_logo

Bálint Lukács . 2024-06-21

MORE AT Google

Can't recommend Rabbies enough. The food is absolutely spot on. A good recommendation if you're ever feeling a bit under the weather, is to have their Veggie Noodle Soup. It really perks me up every time and I feel energised after it!

site_logo

Andrew Davies . 2024-06-16

MORE AT Google

Came across this place by accident but what a find, really authentic food and service by the chap was excellent, couldn't be any more friendly. Food was excellent value for money, massive portions for under a tenner.

site_logo

James Chan . 2024-05-23

MORE AT Google

Honestly, compared to all the Asian restaurants/takeaways I’ve been to in Manchester.. this is the absolutely king. Great quality and pricing. The Pad Thai is to DIE for and the staff are absolutely amazing. Honestly such a gem of a place and I wish the staff the best with the demand.

site_logo

Tom Bond . 2024-05-15

MORE AT Google

Waiting time is too long....Amazing food and customer services ....

site_logo

seban baby . 2024-05-15

MORE AT Google

Lovely little place tucked away, loved their attention to detail and personalized service, solid team looking after the area. We had their Pad Thai and Hainanese Chicken, it was great and will definitely visit again when in the area!

site_logo

GSK . 2024-05-10

MORE AT Google

Best Thai food I ever tasted in Manchester, visited 4th times already. Delicious as usual.

site_logo

Chi Yuen Yip . 2024-05-09

MORE AT Google

Great food all round, great staff.

site_logo

Samuel Jones . 2024-05-03

MORE AT Google

What a gem! Felt like I'm eating in an Asian country somewhere - authentic taste and great flavor! We had the hainan chicken and my husband had the beef flank with ginger rice. Perfectly went well with their sweet soy sauce and sweet and spicy ginger sauce. There's also some additional condiments on the side that you can use as per your liking (my fave is the peanuts as it works well with the chicken and the ginger rice). Will definitely be back to try the noodle dishes next time!

site_logo

IsItaBlog . 2024-05-03

MORE AT Google

Amazing food and service, well worth the short Tram ride from the airport.

site_logo

roryandliz . 2024-04-30

MORE AT Google

Owners are friendly and welcoming, the place is small and cosy, gets packed quickly. The food is spot on and prices affordable. Can't ask for more really.

site_logo

Joe millionaire . 2024-04-27

MORE AT Google

If you want to feel Asian spirit that's the right place. Perfect food

site_logo

Daniel K . 2024-04-27

MORE AT Google

Delicious Thai food, good within UK

site_logo

Victor Lou . 2024-04-24

MORE AT Google

Went for my eye test at Specsavers got lost on the way and landed up in here for some lunch. What a fantastic gem of a place the daughter had a grilled chicken Pad Thai spot on , a huge portion maybe to big would be.my only slight criticism but that is obviously subjective. I had the braised flank of beef with ginger rice nicely cooked flank. 2 cans of pop for the princely sum of £21. One cannot argue with that and the place was busy busy ,nice touches like homemade condiments as well. great atmosphere a real asset to the area.places like this are what makes life so much more enjoyable .I shall be back when I come to pick my glasses up.

site_logo

Daniel Leaman . 2024-04-13

MORE AT Google

Brilliant food. Staff super. Seating a little cramped. Drinks were too expensive, £1.50 for a 330ml can when a 1.5l bottle could be bought in Poundland for same price.

site_logo

Ken Wylson . 2024-04-06

MORE AT Google

The best food in this area❗️🍜🍝🔥Love it💥

site_logo

KAMIL P. . 2024-04-03

MORE AT Google

Wow!!!!! The food, oh my goodness...... amazing! I can honestly say, hand on heart ❤️ that this was one of the most amazing dishes I have ever eaten. The friendly welcome when you enter the hut and its so cozy. The wonderful Taylor made a delicious creation. This is a 'must visit'. I will definitely be returning. Thank you Rabbie's for giving me a full tummy and a huge smile on my face. Visited again today as I loved the food so much last time. Yet again it was a wow! The food, service and the flavour 😋 is unbelievable 👌.

site_logo

Tara . 2024-03-28

MORE AT Google

The best authentic food around.

site_logo

Stepan Kolesnik . 2024-03-26

MORE AT Google

Quick service, great food, good value for money

site_logo

Ku Law . 2024-03-23

MORE AT Google

Took a client got him a takeaway he loved it!

site_logo

Lennox Braithwaite . 2024-03-14

MORE AT Google

Very delicious Thai food, but the queue time to get in is very long and it takes a while for the food to be served. The waiting time is too long and it is really frustrating. I hope it can be improved.

site_logo

Molly Smith . 2024-03-12

MORE AT Google

Don’t try the noodle soup as it tastes far too sweet.

site_logo

Yowin . 2024-03-09

MORE AT Google

Simply Fantastic!! Very authentic food with different spicy sauces. Good quality food. Pork and beef Phad Thai is really good. Grilled chicken and rice is also super delicious. Very good service.

site_logo

Prem . 2024-03-07

MORE AT Google

Delicious food and service speaks for itself. They let an elderly woman order after closing time and eat inside until she finished.

site_logo

Mystic . 2024-02-28

MORE AT Google

Friendly staff, big portions, and the food is incredibly yummy!

site_logo

Alisha . 2024-02-27

MORE AT Google

Nice cozy place, staff are friendly. We had soup noddle, the soup was hot enough, didn’t expect such a big portion it’s really amazing and most importantly, Delicious! Price is reasonable too, will definitely come back next time.

site_logo

Ming Ming Huang . 2024-02-26

MORE AT Google

One minute yer in the jungles of Wythenshawe. Next minute you're in Thailand. It really transports you there with the decor, ambience and food. 100% Recommended.

site_logo

nick greenwood . 2024-02-26

MORE AT Google

- I ordered pork noodle soup while my husband had hainanese chicken rice. Both of them are delicious. If you love spice, please don't forget to dip your chicken or pork to the spicy chilli condiment served on the table. It's amazing sauce. - Make sure to come early as it's getting busier after lunch time. We must waited for half an hour until we got the table, but it's not a big deal. If you ordered takeaway, it's faster I reckon. The staff who greeted us was very friendly and kind. - the price? Oh Good Lord! It's super affordable. The Hainanese chicken rice can feed one hungry man or two person who just want to have a snack.

site_logo

Dianita Hapsari . 2024-02-24

MORE AT Google

Omg the beef soup noddles CANNOT be beaten! Friendly staffs also love it !

site_logo

Wing Kiu Li . 2024-02-24

MORE AT Google

I ordered beef noodle, very yummy. And price is good too. *I went there again with my friends. The food is never let you down esp. the yunmy beef noodle and hainan chicken rice. Price is competitive.

site_logo

A C . 2024-02-18

MORE AT Google

First time visit, definitely not the last, food was amazing, best pad Thai I have ever had

site_logo

Katie Molyneux . 2024-02-17

MORE AT Google

Always so friendly and welcoming. The food state absolutely amazing! Has definitely made Wythenshawe a lot better with these guys being here.

site_logo

Shanice Nunn . 2024-02-13

MORE AT Google

Yummy Thai dishes, at reasonable price

site_logo

Y T . 2024-02-13

MORE AT Google

Good Thai restaurant with good quantities and at a good price. They have three tables counted to eat inside and take away option. Totally recommended.

site_logo

Jaume Soler . 2024-02-09

MORE AT Google

Never had anything from here Not my kind off food The 2 star because i can't rate somthing i will never try

site_logo

Becky . 2024-02-02

MORE AT Google

Amazing street food, giving you a taste of Thailand - we had rice and pad Thai and both were delicious! We went for take away and waited for about 30-40mins but definitely worth it. Portions are big and the customer service is great. Thank you Robbie and team!!!

site_logo

Radina Ivanova . 2024-01-31

MORE AT Google

Good tasty food. Ample portions. Great value. Staff helpful, polite and friendly.

site_logo

Ambridge Massive . 2024-01-30

MORE AT Google

Saw it on the local paper and decided to make a visit and try it out. Upon arrival on Saturday afternoon there is a queue outside, the small hut can house about 16 people and it didn't take too long to be let in, about 30 mins or so. The owner was friendly and offered free drink to all due to the long wait. The Pad Thai with prawn was authentic and quite nice, while the portion doesn't seem large it fills you up with no problem. Will go again to try the noodle soup.

site_logo

William Kan . 2024-01-30

MORE AT Google

Amazing place in the heart of the Wythenshawe Forum. Serving 200 covers per day. Incredible cooking, service and atmosphere.

site_logo

Jaydeep Sarma . 2024-01-27

MORE AT Google

My mixed Chicken and Prawn Pad Thai was delicious. Thai street food in Wythenshaw!? 🤔 Rabbie's noodle bar in civic centre. 😋

site_logo

Peter Magee . 2024-01-23

MORE AT Google

Absolutely delicious! Will certainly be back. I saw a review the other day in the Manchester Evening news and knew I had to try this place. Place was busy and packed with happy customers. I took my food home, emptied into a bowl and it overflowed my bowl, huge portions for such a great price. Very friendly people too, can tell they put their heart into the place. Thankyou

site_logo

Duncan Modelly . 2024-01-22

MORE AT Google

This is a little piece of thia heven you will not get a better meal any were in Manchester being a chef i can appreciate amazing food this os the next level fool you if you don't get the tram there and try it food is there life and it shows just wish it was in Stockport they need to do foody Friday they would blow the competition away Stockport needs the noodle hut 🛖

site_logo

Neil Isherwood . 2024-01-20

MORE AT Google

Delicioso muy deliciosa comida, el sabor de este lugar es único no vas a encontrar otro en Mánchester como este.

site_logo

Hector Molina . 2024-01-20

MORE AT Google

I've been a chef for many years I always try different places Most are hit and miss. Not this place the food is amazing and the place has character, Genuine food it's consistently tasty every time. Now we are regulars Very authentic food

site_logo

Ell T . 2024-01-15

MORE AT Google

Let me start my first saying, i have been walking past this place for so long, enjoying the amazing scents coming from within, but due to health issues, i could not eat certain things. So i said when i was better, this was the top of the hit list.... today was that day! And my god, they do not disappoint. For starters you are hit by the smell of what you know can only be something epic, then you are greeted by friendly knowledgeable people, the bloke who served me gave me a recommendation for the pork pad thai... let me tell you this... authentic is a word i can finally use happy in the knowledge it's bob on, so much flavour, perfect texture, and the portions are superb. i didn't think i would finish, but i powered through, and thank god i did. Thanks for the fantastic service. This is now going to be my weekly hangout.

site_logo

Rick Higgins . 2023-12-23

MORE AT Google

Similary restaurants in North West

restaurant_img
4.9

4039 Opinions

location-iconUnit 2A, The Printworks, 27 Withy Grove, Manchester M4 2BS, United Kingdom
outdoor_seating_359759takeaway_359759delivery_359759

Amy was really helpful and friendly, helped me score my eight points

restaurant_img
4.9

172 Opinions

location-icon214 Claremont Road
African
outdoor_seating_324114takeaway_324114delivery_324114

Must try!!! Very pleased with the food. A new taste which we were all happy with. Amazing atmosphere a great place for friend and/or family.

restaurant_img
4.9

293 Opinions

location-icon64-72 Spring Gardens, Manchester, M2 2BQ, United Kingdom
outdoor_seating_357809takeaway_357809delivery_357809

Top end venue with exceptional service & drinks. A must visit for cocktail lovers

restaurant_img
4.9

34 Opinions

location-iconUnit 18, Piccadilly Trading Estate, Track Brewing Co, Manchester M1 2NP, United Kingdom
outdoor_seating_366212takeaway_366212delivery_366212

Me and my brothers had three different pizzas.....they were amazing. I don't think I've ever eaten better pizza anywhere, and I'm pretty old and eaten a hell of a lot of pizza. I highly recommend

restaurant_img
4.9

762 Opinions

location-icon72 Great Ancoats Street, Manchester M4 5BG England
Seafood
outdoor_seating_272315takeaway_272315delivery_272315

Really enjoyed this restaurant. Beautiful place, lovely staff and very different and interesting dishes, all cooked to perfection. My new favourite restaurant.