GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 3.736 opinions finded in 4 websites

site_photo4

Nº 214 in 664 in Harrow

Nº 1 of 3 Thai in Harrow

CUSTOMERS TALK ABOUT DISHES WITH..mustfriedspicyladyprawnsfishvegetablesvegetablesoupoldchilliriceducksaladcurryprawnchickencookednoodlescoconut

comment_iconOpinions

When visiting the Harrow area, you must come back and stop by this Thai restaurant every time. Impressed with the taste of Thai food. You can choose the spiciness. What level of spiciness do we want to eat? The chef can arrange it as you wish. It is a small restaurant with simple decorations. warm atmosphere Especially the auntie who owns the shop is very kind. He likes to come out and talk and welcome customers in person. It felt like we were eating at a relative's house. It was very good. I recommend that you try this restaurant. 5555++

site_logo

doojingjung . 2024-09-15

MORE AT Google

Ordered for delivery on deliveroo - very disappointing experience. Poor preparation of the food, my noodles arrived soggy/stuck together and oily - my plate is currently swimming in oil. Chicken breast pieces in the noodles were huge and lacked flavour. The spring rolls weren’t very flavourful either and you only get 5 for £8. The best thing I ordered were the pandan pancakes but for £5 I was expecting more than two tiny spring roll looking pancakes. Food and money wasted.

site_logo

Rasheeka LDN . 2024-08-25

MORE AT Google

The worst padthai I ever eat! The noodles tasted horrible and the colour was kinda orange, like it was seasoned with curry? Just not a real thai noodles at all!

site_logo

Hanatali de Carli Lima . 2024-08-18

MORE AT Google

I am here to write this because Deliveroo don't care and told me to just leave feedback for the restaurant to help them improve. So here I am. The good news is the food is flavoursome and the quantity is good. The bad news is that a lot of oil is used in the red and green curries - our plates were glistening with the oil as was our rice. It made the meal so heavy and the whole family is now trying to have fizzy drinks to help and take Rennies. The other issue we had today is there was a type of fish in our noodles which we all didn't like when the protein I'd ordered was vegetables. This is serious if any of us had an alergy. We've ordered before and it was ok ... but won't be ordering again. If you're getting your food through Deliveroo don't imagine you'll be refunded in any way even for errors.

site_logo

Therese Langford . 2024-08-13

MORE AT Google

Excellent as always Prawn Toast is a bit expensive for the portion size though

site_logo

Paul . 2024-08-03

MORE AT Just Eat

Best Thai food in the area! Fresh, fragrant dishes.

site_logo

Tarun Wagjiani . 2024-07-28

MORE AT Google

This order was not delivered or received. Please refund asap.

site_logo

Johanna . 2024-07-27

MORE AT Just Eat

The order arrived minus the dessert...which I have been refunded for. I ordered Perrier water and a different brand of mineral water was delivered. The food was OK but uninspiring. Disappointing.

site_logo

david . 2024-07-27

MORE AT Just Eat

Delicious Food and great portions.

site_logo

Pauline . 2024-07-25

MORE AT Just Eat

Ordered a Deliveroo costing nearly £60s last week, 3 of the dishes was quite awful. Prawn Toast had no Prawns, it was very thin just like fried bread and 2 of the dishes was extremely salty Stir Fried Broccoli and especially Pla Pad Cha, never eaten anything so salty before. Maybe the jar of salt went in. Many years ago the food was quality but now I won't ever order from this place again.

site_logo

Jimmy Tse . 2024-07-24

MORE AT Google

unable to rate as it never arrived, was called by the restaurant though that made me aware it was never picked up or cooked as they were never told to do so, so nothing against the restaurant itself

site_logo

Joe . 2024-07-16

MORE AT Just Eat

Very bad food raw chicken very sweet and smells rotten and is cold

site_logo

kamala Edunoori . 2024-07-13

MORE AT Google

They didn't send the actual item. They just sent me some rice wrapped in a plastic foil.

site_logo

Apeksha . 2024-06-21

MORE AT Just Eat

Good food .small cafe type restaurant more of a takeaway.. a bit expensive . But they do cater for vegans

site_logo

Parimal Mehta . 2024-06-11

MORE AT Google

Food is not great at all, do not waste your money. -Pad Thai with chicken: decent enough taste, not much chicken and nothing amazing. - crispy shredded duck: disgusting. Tiny portion of meat, extremely dry and tasted stale, duck appeared like it was ground down to almost a powder, no decent shredded pieces in it. Sliced onions, cucumber and carrots were dry and stale. The sauce was unbelievably salty. -pork with Thai basil: the pork was so chewy and had lots of fat. Very small portion of meat. Sauce taste was not bad.

site_logo

Punam Patel . 2024-06-11

MORE AT Google

Came in here because I needed to charge my phone to get home. Staff were kind enough to let me charge and use the washroom without ordering any food. I eventually got food anyway because I felt bad and it ended up being so good! Had the basil fried rice with chicken and it was delicious! Really nice staff and good food!

site_logo

Lothika Shan . 2024-06-10

MORE AT Google

Tables are greasy and sticky. Very oily starter. Small portions mains for the price. Seating is not comfortable. Very bad experience overall.

site_logo

Subashini Nagarajan . 2024-06-04

MORE AT Google

spoke about hating mushrooms and was perfect!!!! thank you to the polite lady on the phone! 10/10 service

site_logo

greg . 2024-06-02

MORE AT Just Eat

Last time not a good experience This time was fantastic! Lady I spoke to about no mushrooms make sure was perfect and it was delicious.... thank you lady on the phone .... was delicious

site_logo

Greg clarkson . 2024-06-02

MORE AT Google

Good food, small bur friendly atmosphere

site_logo

Fripps A . 2024-05-28

MORE AT Google

We have ordered from cooper Thai a few times at lunch. Will not be ordering again. The food has definitely gone done hill. Burnt pad thai.the Chicken taste gons off. The chicken chow mein abd special friend rice tasted like oily.

site_logo

Vanisha Patel . 2024-05-25

MORE AT Google

Didnt actually eat in the resturant, instead orderd a takeaway, it was all delicious, great thai food. The set menus have so many bits on them all nice portions and all very tasty, will certainly be going back hopefully to the resturant next time. The dim sums were perhaps the best i have had.

site_logo

ViviTheMage . 2024-05-22

MORE AT Google

Been eat here for at least 15 years of excellent 👌

site_logo

peter john . 2024-05-21

MORE AT Google

Shocking service with 2hr wait between starter and main. We have frequented Cooper Thai for over 10years. After a hiatus of 3 years we returned last night to celebrate a birthday and we were left massively disappointed hence the rating. We arrived at 7pm as a group of 7 adults and left at 10.30pm. Our orders were taken the starters took a while but we're nice and tasty. However when it came to the mains, where the order was given at the same time as the starters for efficiency we were left waiting 2hrs for food as the staff were prioritising delivery drivers. Not only did we feel forgotten, the orders arrived staggered and several people were left out as they missed items meaning some of us were waiting whilst others were eating, and forgotten orders took 15mins to come which highlights that the 2hr wait inbetween starter and main was completely ridiculous. Whilst we didnt cause a fuss when waiting as we had good company as it got to 2hrs of waiting we had asked and were told 5mins on several occasions. The blond lady that works there gave no eye contact or smile and it wasn't the face of someone who should be in customer facing positions as she is compeltely unapporachable. There was no apology by the staff, or attention given, and to say the least we were left disappointed quite deflated. We paid our bill and left and don't think will be rushing to come back based on service. I would suggest that Cooper Thai take a look at the kitchen service/operations and whether they can manage delivery and in-house service as from last night's display it doesn't seem they can do both effectively and efficiently. Food: tasty but very salty.

site_logo

Sara T . 2024-05-19

MORE AT Google

Ordered foot Saturday night and got a Pad Thai - have had savage food poisoning since 2am Sunday morning and still suffering now. GROSS

site_logo

yazmine gattiker . 2024-05-06

MORE AT Google

Ordered via UberEats, the first delivery driver cancelled and it took a while to find a new one - not the restaurants fault. What was the restaurants fault however, was the chicken pad thai causing a friend get food poisoning and has spent the past 48 hours violently vomiting, diarrhoea, hot and cold sweats, fever, stomach cramps, you name it. We were staying 2.5 hours from home in a hotel, had to pay £99 for an extra night in the hotel (as she was unable to leave the bathroom, let alone the hotel room) and rebook coach tickets for the day after, costing another £35. We only received a £10.20 refund from UberEats, after having to spend almost £135 extra due to all this. Avoid this place like the plague if you enjoy being able to move without liquid coming out of each end.

site_logo

Scar Edwards . 2024-05-06

MORE AT Google

the rice was undercooked and the massaman curry is not the same as before.

site_logo

Kim . 2024-05-02

MORE AT Just Eat

Just order a delivery foooooood is boom very tasty only one problem enroll are very different and small from how it comes normally at Thai restaurants didn't like them at all

site_logo

Lion Sabbo . 2024-05-01

MORE AT Google

Amazing food with sufficient quantity. Lovely authentic flavours. The place is small but service is amazing! Also the restaurant is unlicensed for alcohol but you can get your own drink and not get charhed for glasses or corkage. Thoroughly enjoyed the food! Would definitely recommend the garlic chicken with egg fried rice as well as the stir fried rice with pineapple and cashews. Would visit again for sure!

site_logo

Avanti Shinde . 2024-04-30

MORE AT Google

The food was delicious however our enjoyment was slightly affected by incomplete menu information. Many of the items on the menu contain nuts but they have a note to inform you, my friend is slightly allergic to nuts so made sure to pick an item that had no mention of nuts, Special Fried Rice with Pineapple (Khaow Phad Suparod), however when it arrived he found it did contain nuts and had to remove them. I ordered the Ped Katat Ron Sizzling Chilli Duck, the description of which is "Stir-fried duck with chilli, garlic, peppers and spring onions" however when it arrived it also contained a lot of mushrooms which I extremely dislike so I also had to pick out all the mushrooms so I could enjoy my food. If the menu was accurate we could have ordered something else or left a note to not include those ingredients.

site_logo

Paul . 2024-04-29

MORE AT Just Eat

Average food taste, pricey, small quantity, annoying service charge on top of each dish charges. We had much better Thai food at other places, not really recommended the dishes we ordered.

site_logo

Soumya Sen . 2024-04-27

MORE AT Google

food was to my neighbour at 14B instead! SMH!

site_logo

Jee . 2024-04-26

MORE AT Just Eat

The food had less meat and more vegetables - rather should be equally portioned. Disappointing

site_logo

Sefali . 2024-04-14

MORE AT Just Eat

Driver friendly and polite, tasty food

site_logo

Sally . 2024-04-14

MORE AT Just Eat

After coming back from Bangkok, we really missed a lovely thai food, but the experience was so bad, and i never ever so ever, triy the food. So disappointing .

site_logo

masood samavati . 2024-04-01

MORE AT Google

Food was super bland. Not Thai food

site_logo

Jasmin . 2024-04-01

MORE AT Google

Usually get take away but ate in. Not disappointed. Good service small and cosy.

site_logo

Susmil Patel . 2024-03-16

MORE AT Google

Great family run place and have been here multiple times. Great to byob however the prices do justify the increased markup in the food. The starters were very mixed and very oily. Mains were very great especially the Thai and Masamman curries. Only improvement I ask is to staff to stop smoking at the back as the smell comes to the restaurant.

site_logo

Dip G . 2024-02-29

MORE AT Google

The green curry was quite watery and didn't have the usual taste this time. We always order from this restaurant and it's been good but this time the green curry was disappointing

site_logo

Shraddha . 2024-02-18

MORE AT Just Eat

I totally love this small but amazing restaurant, the food is fab, staff are so friendly and warm, and you can take your own alcohol 🍸 😀

site_logo

J K . 2024-02-13

MORE AT Google

Delicious food, generous portions, good price, fast delivery. Highly recommended. I just wish the bag arrived tightly closed, sealed.

site_logo

Marcel . 2024-01-30

MORE AT Just Eat

The worst food I have had. Absolutely disgusting food taste very bad. Smelt horrible would not recommend to anyone. Missing items

site_logo

Raed . 2024-01-21

MORE AT Just Eat

Delivery was on time. But the freshness of the food was poor. Looks like standards here have gone down. Food used to be great here :(

site_logo

Rajiv . 2024-01-19

MORE AT Just Eat

I've had the delicious Red Panang Chicken Curry 🍛 three times from and it's always first class 🥇

site_logo

Caidian Johnson . 2024-01-14

MORE AT Google

The food is very. very bad quality. the Tom soup is literally water with 2 x prawns, uncooked mushrooms and uncooked cherry tomatoes. thrown away. so very disappointing.

site_logo

Rachel . 2024-01-13

MORE AT Just Eat

Very disappointing. Ordered from Uber eats, first delivery was undelivered by Uber eats - admittedly not the restaurants fault. So reordered and the restaurant cancelled the order just as the driver was arriving to collect it - total waste of time, would not recommend.

site_logo

Phil Andrews . 2024-01-12

MORE AT Google

Very disappointing. Food came too quickly to have been prepared fresh. Used to be a very good restaurant but the quality has gone downhill. Will not order from there again.

site_logo

Heidi . 2024-01-10

MORE AT Just Eat

Not as good as usual unfortunately: the egg-fried rice was very soggy and the beef a bit too chewy. I hope it will be better next time.

site_logo

Marcel . 2024-01-10

MORE AT Just Eat

Delicious food and great value for money. I would recommend anything on the menu. My friend and I opted for the set menu option 1 and got a lot of variety for £25 each. Absolutely amazing 🤩

site_logo

TJ Narayan . 2024-01-09

MORE AT Google

Delicious food. Generous portions. Good price. Fast delivery. I just wish the order was delivered in a tightly closed or sealed bag for security & hygiene reasons.

site_logo

Marcel . 2024-01-06

MORE AT Just Eat

Always love getting Thai from here! Super tasty and well cooked. Soup was a little cold but everything else was spot on. Highly recommend Cooper Thai!

site_logo

Roopal . 2024-01-05

MORE AT Just Eat

Great spot for lunch. Tried it for the first time a few weeks ago and went for the second time. Food is good and it's reasonable. You should also ask for some chilli oil, so good to mix it in the food

site_logo

Frank Higwanz Higgins . 2023-12-31

MORE AT Google

Excellent prepared and very tasty Thai food which we had as a takeaway.

site_logo

John Poole . 2023-12-20

MORE AT Google

Nice and spicy Jungle Curry; Prawn toast did seem a bit expensive for what it was but still tasty

site_logo

Amile . 2023-12-18

MORE AT Just Eat

It was a small boutique styled restaurant which looked like a café with wooden chairs, and the food was alright.

site_logo

dilesh tanna . 2023-12-14

MORE AT Google

Great experience with my first order. Food was a bit salty but tasty in general. Super fast delivery which I wasn't expecting based on previous experiences with other restaurants. I'll order again!

site_logo

Rene . 2023-12-12

MORE AT Just Eat

I wasn’t personally a fan of this food i found it quite plain and bland

site_logo

R L . 2023-11-30

MORE AT Google

The quality of the food, unfortunately, has dropped. We have ordered many a time but this we were slightly disappointed 😞

site_logo

Sonal . 2023-11-26

MORE AT Just Eat

The food is delicious. We ordered tempura prawns and squid. They were great starters. Then for Mains we had sweet chilli chicken and masamam beef - I really recommend masamam beef curry. You have to order rice separately.. rice portion is a bit smaller than expected. Service was excellent.

site_logo

Nandu Nair . 2023-11-23

MORE AT Google

Nice cosy place with excellent food. The service is warm and friendly. It is BYOD place so keep that in mind. I wish we knew this before we dropped by. The parking is a huge challenge. We had to circle around for a long time before finding a spot and walking back 15 mins. Will I choose to go again. Yes. For the food. The squid tempura was excellent.

site_logo

Sandeep Araujo . 2023-11-22

MORE AT Google

The second time I order from Cooper Thai. Great choice of dishes, delicious food, generous portions, fast delivery. I just wish the food was delivered in a sealed bag.

site_logo

Marcel . 2023-11-22

MORE AT Just Eat

I called Cooper Thai after I ordered to see if they could deliver my order earlier as we were in a rush. They were very helpful. Food was good.

site_logo

Amy . 2023-11-08

MORE AT Just Eat

Go there for the food! There is no vibe, the place is tiny and the tables are too close to each other. Also you could tell that the waiter is still learning and possibly underpaid. The food was great though and I would definitely go back for it.

site_logo

Toni Stoyanova . 2023-10-21

MORE AT Google

Prawn crackers tasted off for some reason.

site_logo

Pravin . 2023-10-20

MORE AT Just Eat

Good food. Delivered promptly. Perfect

site_logo

Julie . 2023-10-20

MORE AT Just Eat

Yummy food, good portion size, delivered early.

site_logo

Rishi . 2023-10-16

MORE AT Just Eat

Food was AMAZING, first time ordering from Cooper Thai but will not be my last..

site_logo

Allison . 2023-10-11

MORE AT Just Eat

Excellent, and the staff is really nice

site_logo

Julien Mayalu . 2023-10-11

MORE AT Google

We got the lunch time delivery and the chicken was not nice cheap chicken they use we used to eat in here couple years ago and loved it, I think the food quality is not the same anymore

site_logo

Catherine Purcell . 2023-10-06

MORE AT Google

Had a very lovely time here. The food is excellent and the service was very warm and courteous. Almost like having dinner at your moms place. We were very well attended by New who was absolutely friendly and nice. Would certainly recommend 100%.

site_logo

Okechukwu Ibemere . 2023-10-03

MORE AT Google

Ordered on Eats. Pad Khi Mauw was very good..lots of chicken, spice and decent portion..food came warm. Would consider ordering again from here.

site_logo

Chris J . 2023-09-12

MORE AT Google

Das Essen war super. Wir haben ein paar Tage später noch mal Essen bestellt. Da war der Geschmack nicht so toll. Ein Gericht war viel zu scharf. Ich schätze Sonntags ist da sehr viel los, und die haben bestimmt auch verschiedene Köche...

site_logo

Gudrun Boyd . 2023-07-25

MORE AT Google

Excellent food, very friendly service and lovely location.

site_logo

Soraya Portela Lourencani . 2023-07-23

MORE AT Google

Overpriced Terrible food, steer clear!

site_logo

Elaine Egan . 2023-07-23

MORE AT Google

I've ordered takeaway from Cooper Thai before and knew the food would be very good, however I don't think I will return to dine in as I felt the level of service was neglectful bordering on insulting. It was very obvious that attention and space was prioritised towards take away and delivery food, which economically is understandable as that side of their operation appeared extremely busy, however when one has made the effort to go and eat in the restaurant then being made to feel like a burden and in the way, as we were, is unacceptable really. I hope they will improve on this side of things as the food is excellent.

site_logo

Charlie W . 2023-07-21

MORE AT Google

Good food. Take your own wine as the restaurant does not have a bar. Friendly owner. Fun to chat.

site_logo

Prashant Patel . 2023-07-20

MORE AT Google

terrible food. ordered food for my friends house last week. no spice. soup was terrible. watery and big pieces of chicken pieces. noodle was added just colouring. not tasty. put all in bin

site_logo

JA creations and Little Chef Jenuja . 2023-07-20

MORE AT Google

I’ve been ordering from this restaurant for a few months. The food is always excellent quality with fresh ingredients with authentic Thai flavour and always arrives on time

site_logo

Tara . 2023-07-16

MORE AT Just Eat

The best massaman and Thai green curry I have tried.

site_logo

Nirali Patel . 2023-07-14

MORE AT Google

Great food from Coopers as always. We really enjoyed the pad Thai, red curry, som tam spicy salad and ribs. Thank you!

site_logo

Rob . 2023-07-13

MORE AT Just Eat

Tasty, good size portion, good value and good service. Dropped in for no reason than being hungry, glad we did

site_logo

Lee Harvey . 2023-07-11

MORE AT Google

A homey vibe and very accommodating staff that makes you feel special.. It’s our first time to visit as it was highly recommended by locals. Would highly recommend the papaya salad and chicken satay which comes with peanut sauce (to die for).. I just forgot to ask if they sold separately as they were very good. Pad Thai was good but I hope I could have an option to mix with other proteins. Would definitely come back!👌👌👌

site_logo

Gibralyn Abajo . 2023-07-11

MORE AT Google

I ordered this online and the food was great! Seemed expensive but the portions are HUGE! One dish could feed two people. Pad Thai vegetarian and pork was amazing. I have been to Thailand a few times and the flavors are on point! No food poisonings either, which is always an anxiety when ordering new foods online. I hope it stays great!!!

site_logo

Psyduck Psyduck . 2023-07-11

MORE AT Google

Food quality going down and lady at till is very rude.

site_logo

Arin Gupta . 2023-07-07

MORE AT Google

Not what I expected but nice .

site_logo

Don . 2023-07-05

MORE AT Just Eat

Never fails to deliver amazing quality food! I would dine from here daily if i could. Thai curries are always a hit!

site_logo

Ash . 2023-06-19

MORE AT Just Eat

Food quality was terrible. Over spiced with way too much lemongrass. Vegetables severely overcooked. Not going to order again.

site_logo

Rizwan . 2023-06-07

MORE AT Just Eat

Omg 😲 forget chain restaurants! This has to be the very best Thai food I've had in a long time. It's a small independent restaurant in Harrow serving home cooked authentic food. The place is secluded, but minutes away from the station. The Tom Yum Soup, Thai Green Curry (Chicken) & Pork Pad Thai was exceptional 👌 If I had the chance to go again I'd go for sure! It's a must go place, and you got to try it to believe it!

site_logo

Melvin Bartolome . 2023-06-03

MORE AT Google

Food was very average. Sauces were thin and very oily and the duck was very rubbery. The delivery driver also complained about having to deliver to our address and how tricky it was for him. Very unprofessional.

site_logo

Phil . 2023-06-03

MORE AT Just Eat

Love the green tai green and coconut rice here. Great quality food and lovely customer service :)

site_logo

Celine Abira . 2023-05-28

MORE AT Google

Cooper Thai servers authentic Thai cousin. Stuff was super friendly and even made us comfortable by allowing to switch tables as they saw us uncomfortable with the kid. I loved the dishes we ordered and they were yummy! This place doesn’t serve alcohol but allows to carry your own alcohol in the restaurant. Only con I felt was parking during busy hours.

site_logo

Milton Santan Pereira . 2023-05-16

MORE AT Google

Food was hot, fresh, and tasty as always. Cannot help coming back as the food is so good!

site_logo

Ash . 2023-05-15

MORE AT Just Eat

Ribs were not full ribs but rather small pieces of ribs Curry very runny and only 6 small prawns in the entire curry

site_logo

Pratish . 2023-05-13

MORE AT Just Eat

One dish was so full of pork fat I vomited, so I cannot recommend that dish. The other dish was as expected, and was chicken, and the meal was spoilt by the excess fat on the pork. The app or the restaurant refused to take responsibility too.

site_logo

Patrick . 2023-05-06

MORE AT Just Eat

Poor quality - inauthentic Thai

site_logo

N . 2023-04-23

MORE AT Just Eat

The food was really good, but the sauce for the Chicken satay was Sweet chilli instead of the peanut sauce that is advertised and goes perfectly with them.

site_logo

Pratik . 2023-04-19

MORE AT Just Eat

It was ok but needs more authentic ingredients, green papaya in salad etc rather than iceberg lettuce and cucumber and cabbage in the red curry. At £8.50 for the Kake salad, it is what I expect.

site_logo

Lin . 2023-04-06

MORE AT Just Eat

We normally get takeaway but decided to eat in. Food was good as always, we paid and left. The waiter came after us to advise we'd been overcharged. They brought me back in, refunded the difference!! I'd never have known so left them an extra tip..... Good people. Good food.

site_logo

Paolo Arrigo . 2023-04-04

MORE AT Google

All the food was lovely. Unfortunately the pancakes that came with the shredded duck were uneatable. They were stuck together and crumbled to pieces when trying to separate them.

site_logo

Brian . 2023-04-01

MORE AT Just Eat

Good food great portions tasty and packed well. Only issue is driver didn't want to give the receipt and demanded he took the receipt so he gets paid,

site_logo

Bandish . 2023-03-29

MORE AT Just Eat

Similary restaurants in London

restaurant_img
4.0

253 Opinions

location-icon12 Mason's Avenue
Thai
outdoor_seating_152007takeaway_152007delivery_152007

Tried this place out for the first time. Starters were ok, we went for the platter.The main was delicious, we had jungle curry which was really spicy and lamb massam which was real comfort food. The staff were pleasant.The only downside was the building itself was very cold, and there were no heaters that could be switched on. This spoilt the meal as we sat there with our coats.We will go back but in the summer.

restaurant_img
4.0

125 Opinions

location-icon181 Marsh Road
Thai
outdoor_seating_152227takeaway_152227delivery_152227

Food wasn’t bad but terrible value for money in my prawn Tom yum I literally had 2 small prawns. They probably thought being deliveroo they could get a good profit in my ripping someone off they don’t speak to directly. You may of profited well this time but you will never get my business again.