GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4,1

Based on 1.082 opinions finded in 3 websites

4.1Ambience4.6Cuisine4.1Price4.1Service
site_photo4

Nº 621 in 1383 in Leicester

Nº 57 of 137 Indian in Leicester

CUSTOMERS TALK ABOUT DISHES WITH.. salmonricepaycurrycookedtandoorilambchillispicyprawnprawnsfishchickengarlicmeat

comment_iconOpinions

Portions size spot on and food is delicious.

site_logo

Shane Endall . 2024-04-06

MORE AT Google

Last Saturday we came for dinner about 7.30pm Food was stunning, really good portions! Even though it was very busy We had exceptional service from our waiter DJ too who was so lovely!

site_logo

Stacey Phillips . 2024-03-06

MORE AT Google

This is the not the same popular Shimla pinks that we used to dine for the last 10 years. New chef’s, new staff and new taste. The food is average.

site_logo

Chanel Stevenson . 2024-03-03

MORE AT Google

Great food service was brilliant

site_logo

minesh patel . 2024-02-27

MORE AT Google

Central had car wash town central

site_logo

Jay Jay . 2024-02-11

MORE AT Google

The starter was lovely but the mains were sadly to no ones taste. No one could finish their meal and we sadly did not rate this restaurant compared to others around. We also found it very expensive for the service and quality of food. Also, be mindful they automatically add 10% tip to the bill, which I didn't particularly like 🤔 Plus side though.. You did get a lot of food. Overall, we will not be returning or recommending this place.

site_logo

Natalie Watkins . 2024-01-13

MORE AT Google

I have eaten at Shimla pinks many times and ordered many a takeaway so I was very surprised at the quality and taste of the food that I ordered tonight, in my opinion only the rice and naan bread was edible the rest of the meal has been thrown away, I will never eat in or order a takeaway again, it’s a shame because Shimla Pinks used to be lovely.

site_logo

Judith Cherry . 2023-12-21

MORE AT Google

Great hospitality, good food and ambience

site_logo

Aditi Dewra . 2023-12-16

MORE AT Google

2nd time iv been here, amazing food and service - highly recommend

site_logo

Richard Coley . 2023-12-05

MORE AT Google

Great food, and really good service too. No delays.

site_logo

Graham Blackwell . 2023-10-20

MORE AT Google

Visited my daughter and son in law this weekend and jumped off the train to a very rainy Leicester so just literally walked in off the street at tea time so it was obviously quiet but the restaurant was beautiful and the service was brilliant but even if it hadn't been the food would have been enough to bring us back again. The chicken shashlik was divine 😋 and the masala chips were amazing as was everything else. See you next time we visit Leicester 👍👌👌👌👍

site_logo

Denise Hepton . 2023-10-16

MORE AT Google

3 of us went here after it being recommended by our Leicester based staff. Its always a bit of a worry when you're the only customers, which we put down to it being a rainy Wednesday, but we had absolutely no need to be worried. The food and service were both fantastic. Had starters which were almost a meal on their own. Lovely Tikka Masala with pilau rice, really tasty, not too spicy but just enough. Perfect portion size, nice fresh nann bread. The staff were very attentive and provided exceptional service. We'll definitely visit again next time we're working in Leicester, hopefully very soon.

site_logo

Neil Capper . 2023-09-21

MORE AT Google

Came here mid week, early after stepping off a train- a little intimidating at first with the size, but impressive service. Had popadoms to start, very nice and fresh, bit stingy with the pickle tray- then had the Kheema peas peshwari main dish. Superb! One of the best I’ve ever had. It’s hot- I like it that way. A generous portion, with no oily residue at all. Lovely!

site_logo

Anthony Sullivan . 2023-09-19

MORE AT Google

Really enjoyed this Leicester restaurant. Good food and beer too.

site_logo

Martin Lewis . 2023-09-16

MORE AT Google

Very quiet for a Friday night. It was quite early, but that said,almost empty. Group of six, meet up and quick bite to eat before the rugby. Table service a little laboured, but food came out fairly quickly. Very tasty. 2 beers each,poppadoms and pickles, main and a rice, shared nan....£32 each! Service charge already added to bill! Felt it was a touch expensive for what we had.

site_logo

LEE JOHNSON . 2023-09-02

MORE AT Google

Ordered a delivery using Uber eats. Nice food but the portion sizes are really small for the prices they’re charging. £4.50 for chips and i got about 20 small cut fries. £5.50 for chilli paneer and there was 8 small pieces. Food was nice though

site_logo

Gaz Smith . 2023-08-29

MORE AT Google

Very friendly staff and service is impeccable, food was amazing

site_logo

veronica . 2023-07-29

MORE AT Google

Great place food and service was excellent gave a 4 atmosphere as they had just opened and only 8 people in there .. top food will defo be returning

site_logo

Adam Leicester . 2023-07-26

MORE AT Google

Food fantastic, but the service terrible, nearly knock drinks over twice and had to wait for our naan bread a long time, main nearly finished by time it came out.

site_logo

David Munro . 2023-07-16

MORE AT Google

Amazing food and really good service. Will definitely be back thanks for a great evening

site_logo

Tammy Gill . 2023-07-04

MORE AT Google

Food was more than ok and the service was good.

site_logo

Vikas Karan . 2023-07-01

MORE AT Google

Our first visit to shimla pinks indian restaurant was a lovely experience from going in to coming out..the service was excellent by the whole team from table/ bar service to kitchen staff..the meal was delicious meats were lovely and tender shall definately be going there again well done to the whole team..look forward to seeing you again soon...

site_logo

Diane Cooper . 2023-06-23

MORE AT Google

Food was ok. Starters were bland but mains were better. We told the waiter DJ about the starters and he offered us complimentary drinks at the end to make up for it. This was a nice touch.

site_logo

Jay Chauhan . 2023-06-17

MORE AT Google

Awful service, ordered a butter chicken and the chicken was rancid. The guy didn’t even said sorry and was super rude. Really expensive

site_logo

Aarushi Kumar . 2023-06-07

MORE AT Google

Expensive for what is at best is a very average dining experience. Until yesterday, I hadn't been to Shimla Pinks for over 5 years and was disappointed at the quality of the food. Mushroom rice was made with what looked and tasted like dried mushrooms that hadn't been allowed to rehydrate. The main dishes had the onions, peppers etc added late in the preparation making them under cooked. Breads were good, poppadoms were good. Bill arrived and found a 10% service charge added - in all fairness the waiting staff were very good but it should be my choice to add a service charge not ask for it to be deducted. In the past, you never went to Shimla Pinks expecting a bargain but the dining experience sort of justified the cost. Sadly after this recent experience the standard of the food just didn't match the charges.

site_logo

Richard S . 2023-05-28

MORE AT Google

Shimla Pinks never disappoints. Great food and service in a relaxed atmosphere. There's no need to go anywhere else in Leicester.

site_logo

Trev Tyers . 2023-05-19

MORE AT Google

It's always nice to have a meal here. The food is lovely and the people who work here are very nice. The roti bread is sensational 🙂 Definitely worth a visit.

site_logo

Silje Haarr . 2023-05-19

MORE AT Google

They sat us down at the entrance for a while which was rude, there were so many tables available. Luckily a more experienced member of staff seemed to tell him off and sat us down straight away when he saw. Food was OK but for the price it should be better. Naans and tandoori shrimp were very good, Curry and chicken tikka was bang average. Also tried not to apply the £15 reduced offer on our bill despite booking with the code which was a bit cheeky. 10% service charge automatically applied is fine, but not when service is poor. Not a bad visit but probably wouldn't go back.

site_logo

Clayton Helsby . 2023-05-18

MORE AT Google

Wouldn't even give it a 1 star. We dined over the weekend and it was the worst experience ever. Food was slow, poor taste and quality. I ordered Chicken butter masala and it had no flavour. Rude and unhelpful staff. Wouldn't come back here ever again. Interior is old too and not even a nice atmosphere

site_logo

Anjeli Ford . 2023-05-15

MORE AT Google

Staff were not friendly ,no good service ,food were with the same taste n same gravy which is not possible as we had ordered goan curry....

site_logo

Dickson Furtado . 2023-04-30

MORE AT Google

If your passion is Indian food Shimla will cater for all your needs. Chose the Exec banquet for 4, swapped a couple of dishes out due to allergies. This was an absolutely fantastic meal.

site_logo

Kevin Whitcombe . 2023-04-30

MORE AT Google

Old tipe place need a new look Waiting time to long Bad experience over all

site_logo

Vlad Ionuț Banuta . 2023-04-20

MORE AT Google

First class food and service as always. The Tawa is one of the best I have ever tasted. All of our party were very impressed with the standard of food and service. We will all certainly be back again, well done 😋👏👏

site_logo

David Stamp . 2023-04-18

MORE AT Google

Rubbish restaurant and rubbish rude customer service. Wrost food quality... 👎 Restaurant don't know what is the taste of Indian food... 👎👎👎Totally waste of money... 😡😡😡

site_logo

Nihar Gandhi (Nick) . 2023-04-08

MORE AT Google

Substandard food. Horrible chicken tikka, below average lamb chops. King Prawns we’re really nice though. Overall, not recommended for those with an Indian palate.

site_logo

R . 2023-04-02

MORE AT Google

Absolutely beautiful meal, staff were amazing. My dad really enjoyed it too.

site_logo

Elise Evans . 2023-03-28

MORE AT Google

Tasty food with great portion sizes but try to avoid going at a busy time - it can be very difficult to get the attention of staff as they're rushed off their feet. They were very polite, though, so it never felt uncomfortable.

site_logo

Tom Brown . 2023-03-19

MORE AT Google

Service is very poor. Pushy staff. Food is below average

site_logo

filmy fakeers . 2023-03-17

MORE AT Google

first time since lockdown all good

site_logo

the cat . 2023-03-05

MORE AT Google

Great place to take visitors from out of town

site_logo

Divyesh Shah . 2023-02-26

MORE AT Google

First time eating here Friday evening we have been eating Indian food all over the uk and beyond for 35 years and this was sadly one of the worst meals we have ever had. There were 4 of us and we ordered many dishes to share but all were tasteless and bland, the naan breads were the only part of the order worth eating. The staff were efficient but not very friendly and none of them came to ask if we were happy with our food of which most was left un eaten. I have never written a review before good or bad but this was so tasteless and the garlic chilli chicken had lots of very under cooked almost raw garlic in it that it was un edible. If it had been that just one of the dishes lacked flavour it would have been put down to an oversight but you cannot say that for so many different dishes. Indian food should be full of taste but this was the opposite and an expensive waste of money.

site_logo

kevin cornish . 2023-02-04

MORE AT Google

Heard there is a black belt man who is really fit! Can we make this happen?

site_logo

Sara Coelho . 2023-01-28

MORE AT Google

Took my cuzzies from NZ there as they had been on a previous trip and loved it so did we couldnt fault the service or food we will be back👍🏻👍🏻👍🏻👍🏻

site_logo

pirategaza . 2023-01-06

MORE AT Google

Excellent Christmas Day meal, no turkey or sprouts. Really delicious food, exception service! Thank you Shimla Pinks

site_logo

Liz Knight . 2022-12-25

MORE AT Google

Great restaraunt food was great one of the best ive had, staff were attentive and accomodating.

site_logo

scott gordon . 2022-12-17

MORE AT Google

They looked after our extra large group really well. Starters were better than mains but overall the good was very good. Standard Cobra beers etc.

site_logo

Paul Roberts . 2022-12-16

MORE AT Google

overpriced below averge meal restaurant was empty food below average and they had the cheek to add 10% service charge for 3 people with 2 starters one curry each and drinks nearly £100 thats hard earnt money do not recommend and would not return

site_logo

Kelvin White . 2022-12-08

MORE AT Google

Notts ladies Visting Leicesters finest foods. Beautiful food very tasty and served with elegance. Most enjoyable. Would definitely re visit and taste more off the menu Thank you Shimla Pinks

site_logo

Helen White . 2022-11-29

MORE AT Google

Never let you down, always excellent food and service is superb

site_logo

Phil Pearson . 2022-11-12

MORE AT Google

Isn’t worth it. Service too slow, and others were served food although we came a lot earlier, we waited 2 hours on a weekday. Pathetic.

site_logo

Amira Begum . 2022-11-03

MORE AT Google

Did not enjoyed at all. Chicken curry was not cooked properly. Curry was watery nd tasteless.

site_logo

Alisha Kamli . 2022-10-15

MORE AT Google

Just don't noo what this are cook over rated food

site_logo

Mario Gomes . 2022-10-09

MORE AT Google

First time at this restaurant. Very nice place, food was really nice and very good portion sizes. Kind and attentive staff, only thing I would fault was the lassi was watered down too much. Well priced for the quality and quantity, lovely tasting and well presented dishes. The peshwari naan bread filling was not skimped on as some restaurants do which defeats the point. The cutlery even came in a sealed packet with tissue and anti bac hand wipe, very hygienic. Not sure if service charge was optional or not but I would and will pay again as the service was brilliant, we went on a busy Saturday night and could not fault it, orders came out fast with extras as requested and asked during the meal if everything was ok. Also asked if we were ready for next course which is always a plus. If there was no service charge we would have left about the same in a tip anyway. Will definitely be back to try some of the other dishes.

site_logo

Sonny Parmar . 2022-10-02

MORE AT Google

I've been here a few times with friends and the food has always been delicious everytime. Service is brilliant and menu is varied. Would recommend!

site_logo

Rhiannon . 2022-09-29

MORE AT Google

We ordered Peshawari naan, paneer masala, chicken malai starter amount. Really enjoyed the meal.

site_logo

Abhinav Kumar . 2022-09-26

MORE AT Google

Food good,service ok. Not happy with service bill 8 quid.no way guys.

site_logo

Adrian Boyd . 2022-09-23

MORE AT Google

Thought id order as a treat for daughter and grandson Butter chicken and chicken tika both of them tasted like they was made from a tin of tomato soup, platter was nice and rice and nan bread but curry was chicken in tomato soup very disappointed for the price kirsty

site_logo

Sara Peg . 2022-09-17

MORE AT Google

Food was delicious, service very good. Parking was a little awkward when we went but possible.

site_logo

Doug Gregory . 2022-09-04

MORE AT Google

Amazing curry Best in Leicester 🍛

site_logo

Colin Johnson . 2022-08-24

MORE AT Google

Something different. The food is excellent and a bit different from the usual Leicester menu.

site_logo

Tracy Campbell . 2022-07-14

MORE AT Google

My favourite Indian restaurant.

site_logo

Guy van der Walt . 2022-07-14

MORE AT Google

Great food, great friendly service highly recommended

site_logo

Sharon Goodwin . 2022-07-02

MORE AT Google

Not a typical indian restaurant. It wasnt spicy enough to make me feel better

site_logo

GLOBAL NURSE . 2022-06-07

MORE AT Google

We went here for someone's anniversary meal. We were a party of 10 & took the earliest table available - 4:15pm. The food was very tasty & plentiful. We opted for for set menu (to make it easier in a larger group). There was a lot of variety & everything tasted great. Only slight flaw I would pick is that, being the first ones there when they opened, we did have to wait quite some time for our starters. We had to come early due to having small children in the group. I would suggest the restaurant not to offer such an early booking if they still need time to prepare things. Otherwise, the service was overall good.

site_logo

Sandy K . 2022-06-06

MORE AT Google

Lovely staff, great food (most of the time). Used to be our go to. Try a lamb malabar for something a bit different but delicious. Keema rice and lamb biryani are always on our order. Enjoy!

site_logo

Boncesca . 2022-06-03

MORE AT Google

Went there, ordered the lamb with pilau rice, it was very nice but the rice could have been a bit softer, the outstanding part of the night though is after I paid the bill and walked out half way down the street, when the waiter comes running down the street because we were overcharged. Could have easily kept quiet and we wouldn't know but this is exceptional. Would go again.

site_logo

Mowzman D . 2022-05-22

MORE AT Google

Excellent food and service a lot of people there so a bit noisy

site_logo

Taff Williams . 2022-05-21

MORE AT Google

Walked into the restaraunt past a street beggar by the front door. The waiters were pretty sullen, generally unwelcoming and couldn’t speak english well enough to make it an easy experience to order. The knives and forks were presented in a paper bag along with a tissue napkin. For a restaraunt of this genre the prices were high, the food was good but the experience was budget. Would recommend that a takeaway from here would be the better option, would not return for a dining experience.

site_logo

Simon Leonard . 2022-05-14

MORE AT Google

Food was absolutely delicious. Staff were superb. Extremely busy restaurant for a Tuesday evening at 10pm. Atmosphere was excellent. I always recommend this restaurant to my friends and colleagues (that work for Global Payments). Definitely 5 stars for everything.

site_logo

Elisabeth Wilson . 2022-05-12

MORE AT Google

Me and my girlfriend had a lovely night. Food was excellent.

site_logo

louise mcghie . 2022-05-03

MORE AT Google

Slow, took over a hour and half for the food to come... Messed up order, didn't complain just wanted to leave as food wasn't that good. Regret going.

site_logo

Vinnie Sangha . 2022-05-01

MORE AT Google

First time visiting, generous portions & attentive service

site_logo

Davinder Paddam . 2022-04-25

MORE AT Google

Myself and five friends had the most delicious food here. The service was great, the food was fabulous and all 6 of us said it was one of the best Indian meals we had ever had. Will be visiting again.

site_logo

Siobhan A O'Donnell . 2022-04-16

MORE AT Google

2 minutes from our hotel, we were looking for somewhere for dinner. Lovely warm welcome, efficient service and great food. We had the special Tandoor. Well presented, tasty wholesome food. There was nothing to dislike.

site_logo

Darren Lightfoot . 2022-04-13

MORE AT Google

Food was nice . Staff very welcoming. Enjoyed it 👍

site_logo

Si Kinch . 2022-04-07

MORE AT Google

Good -- Ambience and service Average-- Food.

site_logo

Shirshendu Ganguly . 2022-04-02

MORE AT Google

Had a great time lovely service food beautiful I'd recommend to anyone it's a lovely place for familys & couples to enjoy a night out

site_logo

Ellisha Karavadra . 2022-03-29

MORE AT Google

Very please with the dish myself and family ate. I have now gone multiple times and have not been disappointed yet....

site_logo

Julian Simon . 2022-03-27

MORE AT Google

Very good food as always. Chilli Paneer and Naan are awesome

site_logo

Chris Hasler . 2022-03-17

MORE AT Google

Fantastic food and really good service. Had a great time ☺️

site_logo

John Bishop . 2022-03-14

MORE AT Google

Excellent staff and service but so so food

site_logo

Nishaan Khoosal . 2022-02-27

MORE AT Google

Went here with some friends and family, nice sit down restaurant. Waiters really friendly and welcoming. Food was very tasty, nice selection of vegetarian food. I liked how you could watch the chefs cooking behind the glass screen. Definitely recommend.

site_logo

K K . 2022-02-22

MORE AT Google

Really good meals and every time I've been it always comes out hot and the right food arrives. Staffcgreat too.

site_logo

Mark Rushin . 2021-12-04

MORE AT Google

Not what I was expecting at all. Given the brand I was very disappointed with my experience. The waiter was very pleasant and the service was good. However, the food was a let down. We ordered the keema saag and it hardly had any meat. The naans were good. The mixed grill at £16.50 also was well over priced. They just cater for the mass market and I didnt feel it was a worthwhile experience at all.

site_logo

Rag Hulait . 2021-12-04

MORE AT Google

Good food but overpriced. Don't know if it's 100% Halal

site_logo

Anonymous 420 . 2021-11-23

MORE AT Google

Amazing food. Great service. Have been several times and never had a bad meal. Will definitely be going back.

site_logo

Amanda Ivens . 2021-11-15

MORE AT Google

Good service nice food nice place clean place 👌 👍

site_logo

Urmila Patel . 2021-11-13

MORE AT Google

Food was amazing could do with some money spending on it and tidying up

site_logo

Martin Hearn . 2021-11-11

MORE AT Google

My favourite Indian restaurant in Leicester. New menu is great and they are working very hard on keeping us all covid safe. So pleased they are open again.

site_logo

Phil Gilbert . 2021-11-04

MORE AT Google

Went with friends. Great ambience. Great staff. Good food. Nothing great or out of ordinary. Might visit again. Would suggest everyone to get Kala Jamun for desert 💯 and avoid Gajar Ka Halwa at all cost. If you are looking for somewhat good curry to go with naan don't get anything less than medium spicy. I did that mistake even tho I was asked by staff regd my choice. Got sweet chicken tikka curry. Totally not good with naan. 7/10 Overall

site_logo

Febin Koshy Philip . 2021-10-23

MORE AT Google

Food was nice but some in party had to wait a while before whole meal was delivered. Portion sizes quite large, but had price to match.

site_logo

Ray B . 2021-10-17

MORE AT Google

I am not fond of Indian food but, this place makes dishes I like and I even had them packup leftovers which were just as good the next day. Service with a smile too.

site_logo

Robert Paige . 2021-10-12

MORE AT Google

If you are selling wine, then everything becomes "Haram". Your food, money and effort, everything is haram.

site_logo

Yasir Khan . 2021-10-11

MORE AT Google

Shimla pinks is an Indian restaurant. It is a bit pricey but quality was good. The taste of food was excellent. Will recommend before you are put off seeing the price. Service of staff was excellent.

site_logo

JK s . 2021-09-27

MORE AT Google

I'm not happy with taste of the food

site_logo

Sahithya Deepika Puppala . 2021-09-25

MORE AT Google

Fantastic food and great service by d j Thank you

site_logo

mohammad naseeb . 2021-09-22

MORE AT Google

Good food and good service! Much better than when we went 15 years ago! Would go back despite it being pricier!

site_logo

Kajal X . 2021-09-10

MORE AT Google

Great food good quick service the only thing I did not like was the added service charge adds quite a bit to the bill so will not go again

site_logo

David Brooks . 2021-09-04

MORE AT Google

A bit tacky environment inside but food was great.

site_logo

Adam Astley . 2021-08-31

MORE AT Google

The startes were delicious but i ordered malai kofta and it disappointed me.

site_logo

Swarnika Agrahari . 2021-08-05

MORE AT Google

Similary restaurants in East Midlands

restaurant_img
4,1

1301 Opinions

Shiv Sagar Veg Restaurant
location-icon78/80 Belgrave Road Corner of Westbourne street, Leicester LE4 5AS England
Indian

Simply great - food, service, price. Highly recommendable. Friendly staff, nice restaurant, high quality of meals, lots of choice.

salmonricepaycurrycookedtandoorilambchillispicyprawnprawns